Entry information : SiPrx168 (Si039012m)
Entry ID 9510
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status partial
Reviewer Qiang Li
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiPrx168 (Si039012m)
Name (synonym) SiPrx168 (Si039012m)
Class Class III peroxidase     [Orthogroup: Prx109]*
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx168
start..stop
S start..stop
ZmPrx17 342 1e-118 31..289 23..329
SiPrx151 341 5e-118 1..289 1..339
SbPrx21 327 8e-113 25..289 18..331
BdiPrx47 293 3e-99 29..289 25..328
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 51860782..51861015 234 N° 2 51860462..51860650 189 N° 3 51859735..51860178 444  
complement(join(51859735..51860178,51860462..51860650,51860782..51861015))


exon

Literature and cross-references SiPrx168 (Si039012m)
DNA ref. Phytozome 12:   scaffold_9 (51861015..51859735)
Protein sequence: SiPrx168 (Si039012m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   289 (259)
PWM (Da):   %s   30977.47 (27949.9)  
PI (pH):   %s   5.57 (5.30) Peptide Signal:   %s   cut: 31 range:31-289
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARPPMPPVAAVTLCEVLTLAAALGGGVRAQQLSTGYYDGSCPQVHDTVRLIIQQELAAVPGVLAGLLRLHFHDCFVNGCEGSLLLDGTAKLSEKEANPNKGTERLYPVVDNIKAAPEDACPGVVSCADILALAAKASVELMRNLGGAHTYTIGRAHYQSIQDRLYNLKATGQPDPTLDQAHLAELREHCPSATSDSTCLIELDPDTPDTFDNRYYVNLLGKRGLLRSDHAMFSALEEGAESTGPIVGQFASSQADFFQSFATAMVRMGNIAPLTRSMGEVRRNCRVVN*

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from phytozome (Exon 2 is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCGTCCTCCGATGCCTCCGGTAGCCGCCGTAACCCTGTGCGAGGTGCTCACCCTCGCGGCGGCGCTCGGCGGCGGCGTGCGGGCGCAGCAGCTGAGCACGGGGTACTACGACGGC
TCGTGCCCGCAGGTCCACGACACGGTGCGGCTCATCATCCAGCAGGAGCTCGCCGCCGTCCCGGGCGTCCTCGCCGGCCTCCTACGCCTCCACTTCCACGACTGCTTCGTCAAT
GTACGT
GCACGCTTGCGCTTCATGTCCCTTTGCATGCATTGGCACCGTGCCACCGTGGCACCTGCCTCTAGCTGCGTGCCGCTGTCGGATCTGTTCCAATCTGAGTCCTGAACATTGATCATGTGC
TGCAGGGCTGTGAAGGGTCGCTGCTGCTCGACGGGACCGCGAAGCTCAGCGAGAAGGAAGCCAACCCGAACAAGGGCACGGAGCGGCTGTATCCCGTGGTCGACAACATCAAGGCCGCCC
CGGAGGACGCTTGCCCCGGCGTCGTCTCCTGCGCTGACATCCTCGCCCTCGCCGCCAAGGCCTCCGTCGAGCTG
GTCAGTGCCCTGACACGACGACGTAGACGGTGCACAAGTTAATTTG
CTGTTTCAAAGTTCAAACTACCAAGGGTGTGTTTGGCAACTAATGAGAAGGGGTATGGGAATTAGTGGTGGGAGTTGGAGAAGGGAATTCACTCGGGAATATGAGTTTTAGTCACATTCC
CTTATTTGTTTTTTGAGGGAATTAAGAGTGGGAATTTGAGTGAGATTAGATATCCCTTGTTTGGTGTGAGGGTTTAAAGGTGGGAAATTATATCATAAGTTATAATAAACGGTGTAGATG
CGCAATCTTGGGGGAGCACATACGTATACGATCGGCCGTGCCCACTACCAATCCATCCAGGATAGGCTCTACAACTTGAAGGCAACGGGGCAGCCGGACCCGACGCTGGACCAGGCGCAC
CTCGCCGAGCTCCGGGAGCACTGCCCATCGGCGACGAGCGACAGCACGTGCCTGATTGAACTCGATCCGGACACCCCGGACACGTTCGACAACCGCTACTACGTCAACCTCCTGGGCAAA
CGCGGCCTGCTCAGGTCCGACCATGCGATGTTCTCCGCGCTGGAGGAGGGCGCGGAATCCACGGGGCCCATCGTCGGGCAGTTCGCCAGCAGCCAGGCCGACTTTTTTCAAAGCTTCGCG
ACGGCCATGGTCAGGATGGGGAACATTGCGCCGCTGACAAGGAGCATGGGGGAGGTCAGGAGGAACTGCAGGGTGGTGAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCGTCCTCCGATGCCTCCGGTAGCCGCCGTAACCCTGTGCGAGGTGCTCACCCTCGCGGCGGCGCTCGGCGGCGGCGTGCGGGCGCAGCAGCTGAGCACGGGGTACTACGACGGC
TCGTGCCCGCAGGTCCACGACACGGTGCGGCTCATCATCCAGCAGGAGCTCGCCGCCGTCCCGGGCGTCCTCGCCGGCCTCCTACGCCTCCACTTCCACGACTGCTTCGTCAAT
GGCTGT
GAAGGGTCGCTGCTGCTCGACGGGACCGCGAAGCTCAGCGAGAAGGAAGCCAACCCGAACAAGGGCACGGAGCGGCTGTATCCCGTGGTCGACAACATCAAGGCCGCCCCGGAGGACGCT
TGCCCCGGCGTCGTCTCCTGCGCTGACATCCTCGCCCTCGCCGCCAAGGCCTCCGTCGAGCTG
ATGCGCAATCTTGGGGGAGCACATACGTATACGATCGGCCGTGCCCACTACCAATCC
ATCCAGGATAGGCTCTACAACTTGAAGGCAACGGGGCAGCCGGACCCGACGCTGGACCAGGCGCACCTCGCCGAGCTCCGGGAGCACTGCCCATCGGCGACGAGCGACAGCACGTGCCTG
ATTGAACTCGATCCGGACACCCCGGACACGTTCGACAACCGCTACTACGTCAACCTCCTGGGCAAACGCGGCCTGCTCAGGTCCGACCATGCGATGTTCTCCGCGCTGGAGGAGGGCGCG
GAATCCACGGGGCCCATCGTCGGGCAGTTCGCCAGCAGCCAGGCCGACTTTTTTCAAAGCTTCGCGACGGCCATGGTCAGGATGGGGAACATTGCGCCGCTGACAAGGAGCATGGGGGAG
GTCAGGAGGAACTGCAGGGTGGTGAAC

Retrieve as FASTA