Entry information : SiPrx169 (Si039188m)
Entry ID 9511
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-12-15 (Qiang Li)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiPrx169 (Si039188m)
Name (synonym) SiPrx169 (Si039188m)
Class Class III peroxidase     [Orthogroup: Prx087]*
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx169
start..stop
S start..stop
ZmPrx132 563 0 1..358 1..354
ZmPrx53 546 0 1..344 1..348
SbPrx22 515 0 28..313 31..316
OsPrx36 456 8e-160 28..356 31..365
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 56003018..56003224 207 N° 2 56002075..56002941 867  
complement(join(56002075..56002941,56003018..56003224))


exon

Literature and cross-references SiPrx169 (Si039188m)
DNA ref. Phytozome 12:   scaffold_9 (56003224..56002075)
Protein sequence: SiPrx169 (Si039188m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   358 (336)
PWM (Da):   %s   37890.12 (35743.9)  
PI (pH):   %s   4.56 (4.55) Peptide Signal:   %s   cut: 23 range:23-358
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MDARLVTLLLLAAAASAPLASPQLDSAFYKTTCPDAEKVIFDVVQNRFKQDPGTAAGLLRLVFHDCFANGCDASILIDPLSNQASEKEAGPNISVRGYDVIEEIKTELEKKCPGVVSCADIVAASARDAVKLTGGPAYEVPMGRRDSLTSNREDADALPGPDIAVPKLIDEFSKQGFSLEEMIAMLAGGHSIGICRCFFIETDAAPIDPEYRKNISAACDGKDSGTVPMDSVSPNVFDGTYFALALAKKMPLTIDRLVGMDPKTEPVLKAMEAKPADFVPLFAKSMEKLSVLKVLTGKDGEIRKTCSEFNNPQASSDTSVIRISSLNPDQMGLSQPGAAKPAVAEARKVAPGGEEEAT

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from phytozome (3' end is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGACGCCCGCCTGGTGACCCTCCTCCTCCTCGCGGCCGCGGCGTCCGCGCCGCTGGCCTCCCCGCAGCTCGACAGCGCGTTCTACAAGACGACGTGCCCGGACGCCGAGAAGGTCATC
TTCGACGTCGTCCAGAATCGGTTCAAGCAAGACCCCGGCACCGCCGCCGGCCTCCTCCGCCTCGTCTTCCACGACTGCTTCGCAAAC
GTAACGTCTTCCCCGGGTGGCGTTTAATTTCTG
TGCTCCTGCTGCTCTGCTTGATCGATGCATGGTCTCGATGCAGGGCTGCGACGCGTCCATCTTGATCGACCCGCTGTCGAACCAGGCCTCGGAGAAGGAGGCGGGCCCGAACATCTCCGT
CAGGGGCTACGACGTGATCGAGGAGATCAAGACGGAGCTGGAGAAGAAGTGCCCGGGGGTGGTGTCGTGCGCGGACATCGTGGCGGCGAGCGCCCGCGACGCGGTGAAGCTGACGGGCGG
CCCCGCGTACGAGGTGCCCATGGGCCGGCGCGACTCGCTGACGTCCAACCGCGAGGACGCCGACGCCCTGCCGGGCCCCGACATCGCCGTGCCCAAGCTCATCGACGAGTTCTCCAAGCA
GGGCTTCAGCCTCGAGGAGATGATCGCCATGCTCGCCGGCGGCCACTCCATCGGCATCTGCAGGTGCTTCTTCATCGAGACCGACGCCGCGCCCATCGACCCGGAGTACAGGAAGAACAT
CAGCGCCGCCTGCGACGGCAAGGACTCGGGCACCGTCCCCATGGACTCCGTCTCGCCCAACGTCTTCGACGGCACCTATTTCGCCCTCGCGCTCGCCAAGAAGATGCCGCTCACCATCGA
CCGCCTGGTGGGGATGGACCCCAAGACGGAGCCAGTACTCAAGGCCATGGAGGCCAAGCCCGCCGACTTCGTCCCCTTATTCGCCAAGTCCATGGAAAAGCTCAGCGTCCTCAAGGTTCT
CACGGGGAAGGATGGCGAGATCAGGAAGACGTGCTCCGAATTCAACAACCCGCAGGCCAGCAGCGACACGTCGGTGATTCGGATCAGCTCCTTGAACCCCGACCAGATGGGACTGTCGCA
GCCAGGGGCGGCCAAGCCGGCCGTCGCGGAGGCCAGGAAGGTGGCGCCCGGCGGCGAGGAAGAAGCAACC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGACGCCCGCCTGGTGACCCTCCTCCTCCTCGCGGCCGCGGCGTCCGCGCCGCTGGCCTCCCCGCAGCTCGACAGCGCGTTCTACAAGACGACGTGCCCGGACGCCGAGAAGGTCATC
TTCGACGTCGTCCAGAATCGGTTCAAGCAAGACCCCGGCACCGCCGCCGGCCTCCTCCGCCTCGTCTTCCACGACTGCTTCGCAAAC
GGCTGCGACGCGTCCATCTTGATCGACCCGCTG
TCGAACCAGGCCTCGGAGAAGGAGGCGGGCCCGAACATCTCCGTCAGGGGCTACGACGTGATCGAGGAGATCAAGACGGAGCTGGAGAAGAAGTGCCCGGGGGTGGTGTCGTGCGCGGAC
ATCGTGGCGGCGAGCGCCCGCGACGCGGTGAAGCTGACGGGCGGCCCCGCGTACGAGGTGCCCATGGGCCGGCGCGACTCGCTGACGTCCAACCGCGAGGACGCCGACGCCCTGCCGGGC
CCCGACATCGCCGTGCCCAAGCTCATCGACGAGTTCTCCAAGCAGGGCTTCAGCCTCGAGGAGATGATCGCCATGCTCGCCGGCGGCCACTCCATCGGCATCTGCAGGTGCTTCTTCATC
GAGACCGACGCCGCGCCCATCGACCCGGAGTACAGGAAGAACATCAGCGCCGCCTGCGACGGCAAGGACTCGGGCACCGTCCCCATGGACTCCGTCTCGCCCAACGTCTTCGACGGCACC
TATTTCGCCCTCGCGCTCGCCAAGAAGATGCCGCTCACCATCGACCGCCTGGTGGGGATGGACCCCAAGACGGAGCCAGTACTCAAGGCCATGGAGGCCAAGCCCGCCGACTTCGTCCCC
TTATTCGCCAAGTCCATGGAAAAGCTCAGCGTCCTCAAGGTTCTCACGGGGAAGGATGGCGAGATCAGGAAGACGTGCTCCGAATTCAACAACCCGCAGGCCAGCAGCGACACGTCGGTG
ATTCGGATCAGCTCCTTGAACCCCGACCAGATGGGACTGTCGCAGCCAGGGGCGGCCAAGCCGGCCGTCGCGGAGGCCAGGAAGGTGGCGCCCGGCGGCGAGGAAGAAGCAACC

Retrieve as FASTA