Entry information : SiPrx171 (Si039828m)
Entry ID 9514
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiPrx171 (Si039828m)
Name (synonym) SiPrx171 (Si039828m)
Class Class III peroxidase    [Orthogroup: Prx021]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx171
start..stop
S start..stop
OsPrx35 544 0 1..316 4..319
CescPrx60 410 4.36e-145 13..316 29..329
CescPrx62 410 6.79e-145 9..316 22..326
CclPrx110 410 7.38e-145 10..317 25..329
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '9514' 'join(57675734..57675907,57675972..57676163,57676239..57676404,57676505..57676920)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 57675734..57675907 172 N° 2 57675972..57676163 190 N° 3 57676239..57676404 164 N° 4 57676505..57676920 414
join(57675734..57675907,57675972..57676163,57676239..57676404,57676505..57676920 )


exon

Literature and cross-references SiPrx171 (Si039828m)
DNA ref. Phytozome 12:   scaffold_9 (57675734..57676920)
Protein sequence: SiPrx171 (Si039828m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   316 (308)
PWM (Da):   %s   33325.39 (33269.3)  
PI (pH):   %s   5.88 (10.41) Peptide Signal:   %s   cut: 0 range:Ymax-307
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MCAGFPAGGNGALQPNFYGATCPQAETIVRQEVIRWLHSDMGFAAGLVRMHFHDCFVRGCDASILLESTPDNTAERDSPVNNPSLRGFEVIDSAKARLEDACPGVVSCADILAFAARDSV
ALSGGPRYDVPGGRRDGTLSMASEVADNIPAPTFNLDQLTQSFAAKGLTQEEMVTLSGAHTIGRAHCTAFSDRLYNFSATGVADPTLDPPFLAQLQHACPAAGDGGVDPGLVVPMEPRTP
HALDTLYYWGVLRNRGLFASDQALLASAPTAAQVRQSAYGGYPWKLKFAAAMVKMGQIQVLTGGGGQIRAKCSAVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTGCGCTGGCTTCCCTGCCGGAGGGAACGGGGCGCTGCAGCCCAACTTCTACGGGGCGACGTGCCCGCAGGCGGAGACGATCGTGCGGCAGGAGGTCATCCGGTGGTTGCACAGCGAC
ATGGGCTTCGCCGCCGGGCTCGTCAGGATGCACTTCCACGACTGCTTCGTCAGG
GGGTAAACTACCTGACTGGCTCTCCGCATGCAAGCGGCGCACGCGCCCTTAACGATTGCATTGCAG

GGGTGCGACGCGTCGATCCTGCTGGAGTCGACGCCGGACAACACGGCGGAGCGGGACTCCCCCGTCAACAACCCCAGCCTCCGCGGCTTCGAGGTTATCGACAGCGCCAAGGCCCGCCTC
GAGGACGCCTGCCCCGGTGTCGTCTCATGCGCCGACATCCTCGCCTTCGCCGCCAGGGACAGCGTCGCGCTG
TGGTACCTAAAACCTCAACACACACATGCCTCTGCCTGCAGTGACATT
TGACGACCGTGCCGTGGATGGATGTGCAGAGCGGCGGGCCCCGGTACGACGTGCCGGGAGGGCGGCGCGACGGCACGTTGTCGATGGCGTCGGAGGTGGCCGACAACATCCCCGCACCGA
CGTTCAACCTGGACCAGCTCACCCAGAGCTTCGCCGCCAAGGGCCTCACCCAGGAAGAGATGGTCACCCTCTCAG
AGGTACATACGTTTTTCCCAGTGCACGACACGGTCATGTCGCGTT
CCCGTGTGCATGACAGCATGAGCACGACGCGTTCACCTACTGCATATGCCATGGCAGGCGCGCACACCATCGGGCGGGCGCACTGCACGGCGTTCAGCGACCGGCTCTACAACTTCAGCG
CGACGGGCGTGGCGGACCCCACCCTGGACCCGCCCTTCCTGGCGCAGCTGCAGCACGCCTGCCCCGCCGCCGGCGACGGCGGCGTCGACCCGGGCCTCGTGGTGCCCATGGAGCCCCGCA
CGCCCCACGCCCTCGACACGCTCTACTACTGGGGCGTCCTGCGCAACCGCGGCCTCTTCGCCTCCGACCAGGCGCTGCTGGCCAGCGCGCCCACCGCCGCGCAGGTCCGCCAGAGCGCCT
ACGGGGGCTACCCGTGGAAGCTCAAGTTCGCCGCCGCCATGGTCAAGATGGGGCAGATCCAGGTGCTCACCGGCGGCGGCGGACAGATCAGGGCCAAGTGCAGCGCCGTCAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTGCGCTGGCTTCCCTGCCGGAGGGAACGGGGCGCTGCAGCCCAACTTCTACGGGGCGACGTGCCCGCAGGCGGAGACGATCGTGCGGCAGGAGGTCATCCGGTGGTTGCACAGCGAC
ATGGGCTTCGCCGCCGGGCTCGTCAGGATGCACTTCCACGACTGCTTCGTCAGG
GGGTGCGACGCGTCGATCCTGCTGGAGTCGACGCCGGACAACACGGCGGAGCGGGACTCCCCCGTC
AACAACCCCAGCCTCCGCGGCTTCGAGGTTATCGACAGCGCCAAGGCCCGCCTCGAGGACGCCTGCCCCGGTGTCGTCTCATGCGCCGACATCCTCGCCTTCGCCGCCAGGGACAGCGTC
GCGCTG
AGCGGCGGGCCCCGGTACGACGTGCCGGGAGGGCGGCGCGACGGCACGTTGTCGATGGCGTCGGAGGTGGCCGACAACATCCCCGCACCGACGTTCAACCTGGACCAGCTCACC
CAGAGCTTCGCCGCCAAGGGCCTCACCCAGGAAGAGATGGTCACCCTCTCAG
GCGCGCACACCATCGGGCGGGCGCACTGCACGGCGTTCAGCGACCGGCTCTACAACTTCAGCGCGACG
GGCGTGGCGGACCCCACCCTGGACCCGCCCTTCCTGGCGCAGCTGCAGCACGCCTGCCCCGCCGCCGGCGACGGCGGCGTCGACCCGGGCCTCGTGGTGCCCATGGAGCCCCGCACGCCC
CACGCCCTCGACACGCTCTACTACTGGGGCGTCCTGCGCAACCGCGGCCTCTTCGCCTCCGACCAGGCGCTGCTGGCCAGCGCGCCCACCGCCGCGCAGGTCCGCCAGAGCGCCTACGGG
GGCTACCCGTGGAAGCTCAAGTTCGCCGCCGCCATGGTCAAGATGGGGCAGATCCAGGTGCTCACCGGCGGCGGCGGACAGATCAGGGCCAAGTGCAGCGCCGTCAAC

Retrieve as FASTA