Entry information : SiPrx173 (Si040875m)
Entry ID 9516
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status partial
Reviewer Qiang Li
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiPrx173 (Si040875m)
Name (synonym) SiPrx173 (Si040875m)
Class Class III peroxidase     [Orthogroup: Prx042]*
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx173
start..stop
S start..stop
SbPrx124 479 3e-173 1..266 58..323
SiPrx101 479 3e-173 1..266 52..317
SbPrx125 479 3e-173 1..265 55..319
SbPrx123 471 5e-170 1..263 55..317
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1669..1950 282 N° 2 1385..1547 163 N° 3 909..1261 353  
complement(join(909..1261,1385..1547,1669..1950))


exon

Literature and cross-references SiPrx173 (Si040875m)
DNA ref. Phytozome 12:   scaffold_462 (1950..909)
Protein sequence: SiPrx173 (Si040875m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   266
PWM (Da):   %s   29287.91  
PI (pH):   %s   8.06
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
RRVIQDARVSDPRIPASLIRLHFHDCFVQGCDASLLLDDDLPAIQTEKTVPANNNSARGFPVVDDIKRALERACPGVVSCADILALAAEISVEISGGPRWRVLLGRRDGTTTNVQSARNLPGPFDSLDKLQQKFRNVNLDDTDLVALQGAHTFGKVQCQFTRENCTAGQPVGALEDLDRVTPNVFDNKYYGNLVRGQAQLPSDQVMLSDQAAPATTAPIVHRFASNQKDFFRNFVESMIKMGNISPLTGRDGEIRKNCRRVNSKGY*

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from phytozome (Short 5' end is missingà).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CGCCGCGTCATCCAGGACGCGCGCGTCTCCGACCCGCGCATCCCGGCCAGCCTCATCCGCCTCCACTTCCACGACTGCTTCGTTCAGGGCTGCGACGCCTCGCTCCTGCTCGACGACGAC
CTCCCGGCCATCCAGACCGAGAAGACCGTGCCCGCCAACAACAACTCAGCGCGCGGCTTTCCCGTGGTCGACGACATCAAGCGCGCGCTGGAGCGCGCGTGCCCGGGTGTCGTATCCTGC
GCCGACATCCTTGCCCTCGCTGCCGAGATCTCCGTCGAAATC
GTAAGCGTCCGGACCAAGAAACTTGCATTGATCAATATGATCATCAGAGCTACCTACTCTAGCTCCTCACATCTCTCC
TGACGCCCTGAACTGACGGATTCGTCCACGGAACTTGGCACAGTCTGGAGGACCACGCTGGCGGGTGCTTCTTGGCCGCCGAGACGGCACGACGACCAACGTCCAGAGCGCCAGAAACCT
GCCGGGCCCTTTCGACTCCCTGGACAAGCTCCAGCAGAAGTTCAGAAACGTCAACCTCGACGACACTGACCTCGTGGCTCTGCAAG
GTATCGTACACCTACTGAATCCATTCGTTTCAGG
CTTTCAGCAATATAATTTGTACAATTCAAACCTGTAAAATTTTCATATGGCGTGCACACTGATTTCAAAAAAAAAAAAACCTACTTCAGGAGCGCACACATTTGGCAAAGTGCAGTGCCA
GTTCACGCGGGAGAACTGCACGGCCGGGCAGCCTGTGGGTGCGCTAGAGGACTTGGACCGTGTTACACCCAACGTGTTCGACAACAAGTATTACGGCAACCTCGTGCGCGGCCAAGCTCA
ACTGCCGTCGGACCAGGTCATGCTGTCGGACCAAGCTGCGCCGGCGACCACCGCACCCATTGTTCACCGATTCGCGAGCAACCAAAAGGATTTCTTCAGGAACTTTGTGGAATCCATGAT
CAAGATGGGCAACATCAGCCCGTTGACAGGGAGGGATGGAGAGATCAGGAAGAACTGCCGGAGGGTCAATAGCAAAGGCTAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CGCCGCGTCATCCAGGACGCGCGCGTCTCCGACCCGCGCATCCCGGCCAGCCTCATCCGCCTCCACTTCCACGACTGCTTCGTTCAGGGCTGCGACGCCTCGCTCCTGCTCGACGACGAC
CTCCCGGCCATCCAGACCGAGAAGACCGTGCCCGCCAACAACAACTCAGCGCGCGGCTTTCCCGTGGTCGACGACATCAAGCGCGCGCTGGAGCGCGCGTGCCCGGGTGTCGTATCCTGC
GCCGACATCCTTGCCCTCGCTGCCGAGATCTCCGTCGAAATC
TCTGGAGGACCACGCTGGCGGGTGCTTCTTGGCCGCCGAGACGGCACGACGACCAACGTCCAGAGCGCCAGAAACCTG
CCGGGCCCTTTCGACTCCCTGGACAAGCTCCAGCAGAAGTTCAGAAACGTCAACCTCGACGACACTGACCTCGTGGCTCTGCAAG
GAGCGCACACATTTGGCAAAGTGCAGTGCCAGTTC
ACGCGGGAGAACTGCACGGCCGGGCAGCCTGTGGGTGCGCTAGAGGACTTGGACCGTGTTACACCCAACGTGTTCGACAACAAGTATTACGGCAACCTCGTGCGCGGCCAAGCTCAACTG
CCGTCGGACCAGGTCATGCTGTCGGACCAAGCTGCGCCGGCGACCACCGCACCCATTGTTCACCGATTCGCGAGCAACCAAAAGGATTTCTTCAGGAACTTTGTGGAATCCATGATCAAG
ATGGGCAACATCAGCCCGTTGACAGGGAGGGATGGAGAGATCAGGAAGAACTGCCGGAGGGTCAATAGCAAAGGCTAT

Retrieve as FASTA