Entry information : SiPrx20 (Si002252m)
Entry ID 9519
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiPrx20 (Si002252m)
Name (synonym) SiPrx20 (Si002252m)
Class Class III peroxidase    [Orthogroup: Prx166]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx20
start..stop
S start..stop
ZmPrx119 485 3e-174 7..321 16..342
OsPrx02 466 5e-167 25..321 19..317
SbPrx50 458 1e-163 6..321 15..337
BdiPrx51 402 7e-142 25..321 28..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 12932504..12932716 213 N° 2 12932834..12933028 195 N° 3 12933129..12933683 555  
join(12932504..12932716,12932834..12933028,12933129..12933683)


exon

Literature and cross-references SiPrx20 (Si002252m)
DNA ref. Phytozome 12:   scaffold_5 (12932504..12933683)
Protein sequence: SiPrx20 (Si002252m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   322 (298)
PWM (Da):   %s   33703.92 (31180.6)  
PI (pH):   %s   8.58 (8.40) Peptide Signal:   %s   cut: 24 range:24-321
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGWWLSRALWLSALAVVAAGAQAQQLSPGFYNATCPALQAVVRRGVARAVRREPRMGASILRLFFHDCFVNGCDASVLLDDVPGNFTGEKNSGPNANSLRGYEVIDAIKAQVEASCNATVSCADILALAARDAVNLLGGPSWTVPLGRRDARNTSMNAANTNLPPPDASLSTLLSMFRAKGLDARDLTALSGAHTVGQARCAVFRSHIYNDTATNATFAADLRANVCPFTGGDANLAPLDPQAPNAFDNGYFRDLVARRVLLRSDQALYGSGGGNGTTDALVRAYAANGTAFAADFAAAMVRMGSLVGSGGEVRLNCRRVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGTGGTGGCTGTCCCGAGCGCTGTGGCTCTCGGCGCTCGCCGTCGTCGCGGCCGGCGCGCAGGCGCAGCAGCTGTCGCCGGGGTTCTACAACGCGACGTGCCCGGCGCTGCAGGCC
GTCGTGCGCCGCGGCGTGGCGCGCGCCGTCCGCAGGGAGCCGCGCATGGGGGCGTCCATCCTCCGCCTCTTCTTCCACGACTGCTTTGTCAAT
GTACGTAAAACCAGCGAGCGATCCCTT
CCTTCTTGCTCCTTTTGTTTTGGTGGCGGTGGTGTCGCGACCGAGGCGTCGGGCTGAGCTTGGGTGGGTGCCATGTTCGCGCGGTCGCAGGGGTGCGACGCCTCCGTGTTGCTGGACGAC
GTGCCGGGCAACTTCACGGGGGAGAAGAACTCGGGGCCCAACGCCAACTCGCTCCGCGGCTACGAGGTCATCGACGCTATCAAGGCCCAGGTCGAGGCCTCCTGCAACGCCACCGTCTCC
TGCGCCGACATCCTCGCCCTCGCCGCGCGCGACGCCGTCAACCTG
GTCAGTCATTGCTCTCTCGGTCAGTCAGTCAGTCTCTCGATCAGAGCTTGTGGGTTGGCGACACTGACGCCTGGT
GCACGCGTGCCGTGATACAACGCAGCTCGGCGGCCCGAGCTGGACGGTGCCGCTGGGCCGCCGCGACGCGCGCAACACGAGCATGAACGCCGCGAACACCAACCTGCCGCCGCCGGACGC
GAGCCTCTCGACGCTCCTGTCCATGTTCCGCGCCAAGGGCCTGGACGCGCGGGACCTGACGGCGCTCTCCGGCGCGCACACCGTGGGGCAGGCCCGCTGCGCCGTCTTCCGCTCGCACAT
CTACAACGACACCGCCACCAACGCCACCTTCGCCGCGGACCTCCGCGCCAACGTCTGCCCCTTCACGGGCGGCGACGCCAACCTCGCGCCGCTGGACCCGCAGGCGCCCAACGCCTTCGA
CAACGGGTACTTCCGGGACCTGGTCGCCCGCCGCGTGCTGCTGCGCTCCGACCAGGCTCTCTACGGGAGCGGCGGTGGCAACGGCACCACGGACGCGCTCGTGCGCGCGTACGCCGCCAA
CGGGACGGCCTTCGCGGCCGACTTCGCCGCCGCGATGGTGAGGATGGGCAGCCTTGTGGGGAGCGGCGGCGAGGTCCGGCTTAACTGCCGGCGAGTGAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGTGGTGGCTGTCCCGAGCGCTGTGGCTCTCGGCGCTCGCCGTCGTCGCGGCCGGCGCGCAGGCGCAGCAGCTGTCGCCGGGGTTCTACAACGCGACGTGCCCGGCGCTGCAGGCC
GTCGTGCGCCGCGGCGTGGCGCGCGCCGTCCGCAGGGAGCCGCGCATGGGGGCGTCCATCCTCCGCCTCTTCTTCCACGACTGCTTTGTCAAT
GGGTGCGACGCCTCCGTGTTGCTGGAC
GACGTGCCGGGCAACTTCACGGGGGAGAAGAACTCGGGGCCCAACGCCAACTCGCTCCGCGGCTACGAGGTCATCGACGCTATCAAGGCCCAGGTCGAGGCCTCCTGCAACGCCACCGTC
TCCTGCGCCGACATCCTCGCCCTCGCCGCGCGCGACGCCGTCAACCTG
CTCGGCGGCCCGAGCTGGACGGTGCCGCTGGGCCGCCGCGACGCGCGCAACACGAGCATGAACGCCGCGAAC
ACCAACCTGCCGCCGCCGGACGCGAGCCTCTCGACGCTCCTGTCCATGTTCCGCGCCAAGGGCCTGGACGCGCGGGACCTGACGGCGCTCTCCGGCGCGCACACCGTGGGGCAGGCCCGC
TGCGCCGTCTTCCGCTCGCACATCTACAACGACACCGCCACCAACGCCACCTTCGCCGCGGACCTCCGCGCCAACGTCTGCCCCTTCACGGGCGGCGACGCCAACCTCGCGCCGCTGGAC
CCGCAGGCGCCCAACGCCTTCGACAACGGGTACTTCCGGGACCTGGTCGCCCGCCGCGTGCTGCTGCGCTCCGACCAGGCTCTCTACGGGAGCGGCGGTGGCAACGGCACCACGGACGCG
CTCGTGCGCGCGTACGCCGCCAACGGGACGGCCTTCGCGGCCGACTTCGCCGCCGCGATGGTGAGGATGGGCAGCCTTGTGGGGAGCGGCGGCGAGGTCCGGCTTAACTGCCGGCGAGTG
AAC

Retrieve as FASTA