Entry information : SiPrx25 (Si004255m)
Entry ID 9523
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiPrx25 (Si004255m)
Name (synonym) SiPrx25 (Si004255m)
Class Class III peroxidase    [Orthogroup: Prx237]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx25
start..stop
S start..stop
SbPrx57 554 0 22..330 23..331
ZmPrx127 504 0 1..321 1..317
EferPrx24 292 2e-98 10..328 8..324
OsPrx44 290 1e-97 8..328 6..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2880530..2880754 225 N° 2 2880860..2881624 765  
join(2880530..2880754,2880860..2881624)


exon

Literature and cross-references SiPrx25 (Si004255m)
DNA ref. Phytozome 12:   scaffold_5 (2880530..2881624)
Protein sequence: SiPrx25 (Si004255m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   331 (305)
PWM (Da):   %s   34518.93 (31948.5) Transmb domain:   %s   i5-27o
PI (pH):   %s   4.5 (4.49) Peptide Signal:   %s   cut: 26 range:26-330
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARCGAGVTLLLVSLYALLPAITDAGLQEGFYKSNTNCTADVEATVASVVQQYVSADRGVGAGLIRLHFHDCFVKGCDGSVLIDPSPVNPDPEKGSPSNGGLRGLEVIQDAKRQLEGACPGTVSCADILAFAARDASNILSAGAINYGVPSGRRDGLASAASDATQSLPPPFAELGRLTELFAAKGFTQDELVTLSGAHSVGRAHCGSFAERIRPNVSETMDAEYGAGLQRRCAEDAGDGAAVFVDQDQGTPADLDNQYYGNVLAGKVLFNSDWALISDNTTRQMVEGNAANQAQWAAKFIDAMRKMGALDVLTGDQGEIRRFCNVTNSG*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCGTTGCGGCGCCGGCGTGACGCTGCTCTTGGTGTCTCTCTACGCGCTGCTGCCGGCAATCACCGACGCCGGTCTGCAGGAAGGCTTCTACAAGAGCAACACCAACTGCACCGCC
GACGTCGAGGCCACCGTGGCGAGCGTCGTCCAGCAGTACGTCTCCGCGGACCGCGGCGTCGGCGCAGGGCTCATCCGCCTCCACTTCCACGACTGCTTCGTCAAG
GTACGAACCCAAGTT
TGTGGCAGGTAGTTTGACATGAAGTTGAAATGTTGAATTGGCATGAGCATGTACAGCAACTCAATCGCTTTCGTGATGTGTACGTGCCAGGGCTGCGATGGTTCGGTTCTCATCGATCCG
AGCCCCGTCAACCCGGACCCCGAGAAGGGCTCGCCGTCGAACGGCGGCCTCCGCGGGCTCGAGGTGATCCAGGACGCCAAGCGGCAGCTCGAGGGCGCGTGCCCGGGGACCGTGTCCTGC
GCCGACATCCTCGCCTTCGCCGCCCGCGACGCGTCCAACATCCTGAGCGCCGGGGCGATCAACTACGGCGTCCCCTCGGGCCGCCGGGACGGGCTCGCCTCCGCCGCGTCCGACGCCACC
CAGAGCCTGCCCCCGCCGTTCGCGGAGCTTGGCCGCCTCACGGAGCTCTTCGCCGCCAAGGGGTTCACGCAGGACGAGCTCGTCACGCTCTCCGGCGCGCACTCCGTCGGCCGCGCCCAC
TGCGGGTCCTTCGCGGAGCGGATACGCCCCAACGTGAGCGAGACCATGGACGCGGAGTACGGCGCCGGGCTGCAGCGGCGGTGCGCGGAGGACGCCGGGGACGGCGCGGCGGTATTCGTC
GACCAGGACCAGGGCACGCCGGCCGACCTCGACAACCAGTACTACGGGAACGTGCTCGCCGGGAAGGTGCTCTTCAACTCGGACTGGGCGCTCATCAGCGACAACACGACGAGGCAGATG
GTGGAGGGCAACGCCGCGAACCAGGCGCAGTGGGCGGCCAAGTTCATCGACGCCATGCGCAAGATGGGCGCCCTGGACGTGCTCACCGGCGACCAGGGAGAGATTAGGAGGTTCTGCAAC
GTCACCAACAGCGGC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCGTTGCGGCGCCGGCGTGACGCTGCTCTTGGTGTCTCTCTACGCGCTGCTGCCGGCAATCACCGACGCCGGTCTGCAGGAAGGCTTCTACAAGAGCAACACCAACTGCACCGCC
GACGTCGAGGCCACCGTGGCGAGCGTCGTCCAGCAGTACGTCTCCGCGGACCGCGGCGTCGGCGCAGGGCTCATCCGCCTCCACTTCCACGACTGCTTCGTCAAG
GGCTGCGATGGTTCG
GTTCTCATCGATCCGAGCCCCGTCAACCCGGACCCCGAGAAGGGCTCGCCGTCGAACGGCGGCCTCCGCGGGCTCGAGGTGATCCAGGACGCCAAGCGGCAGCTCGAGGGCGCGTGCCCG
GGGACCGTGTCCTGCGCCGACATCCTCGCCTTCGCCGCCCGCGACGCGTCCAACATCCTGAGCGCCGGGGCGATCAACTACGGCGTCCCCTCGGGCCGCCGGGACGGGCTCGCCTCCGCC
GCGTCCGACGCCACCCAGAGCCTGCCCCCGCCGTTCGCGGAGCTTGGCCGCCTCACGGAGCTCTTCGCCGCCAAGGGGTTCACGCAGGACGAGCTCGTCACGCTCTCCGGCGCGCACTCC
GTCGGCCGCGCCCACTGCGGGTCCTTCGCGGAGCGGATACGCCCCAACGTGAGCGAGACCATGGACGCGGAGTACGGCGCCGGGCTGCAGCGGCGGTGCGCGGAGGACGCCGGGGACGGC
GCGGCGGTATTCGTCGACCAGGACCAGGGCACGCCGGCCGACCTCGACAACCAGTACTACGGGAACGTGCTCGCCGGGAAGGTGCTCTTCAACTCGGACTGGGCGCTCATCAGCGACAAC
ACGACGAGGCAGATGGTGGAGGGCAACGCCGCGAACCAGGCGCAGTGGGCGGCCAAGTTCATCGACGCCATGCGCAAGATGGGCGCCCTGGACGTGCTCACCGGCGACCAGGGAGAGATT
AGGAGGTTCTGCAACGTCACCAACAGCGGC

Retrieve as FASTA