Entry information : SiPrx26 (Si005544m)
Entry ID 9524
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status partial
Reviewer Qiang Li
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiPrx26 (Si005544m)
Name (synonym) SiPrx26 (Si005544m)
Class Class III peroxidase     [Orthogroup: Prx013]*
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx26
start..stop
S start..stop
HvPrx57 260 2.02e-91 3..142 1..140
TaPrx05-1A 266 3.88e-91 1..142 191..332
OsPrx1617 265 1.72e-90 1..142 200..341
TaPrx05-1D 264 3e-90 1..142 201..342
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '9524' 'join(18480709..18480837,18480984..18481280)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 18480709..18480837 127 N° 2 18480984..18481280 295  
join(18480709..18480837,18480984..18481280)


exon

Literature and cross-references SiPrx26 (Si005544m)
DNA ref. Phytozome 12:   scaffold_5 (18480709..18481280)
Protein sequence: SiPrx26 (Si005544m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   142
PWM (Da):   %s   15345.57  
PI (pH):   %s   8.9
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGHTIGVGNCNLFSSRLFNFTGKNNPSDIDPSLNPSYAKFLQGQCRRNLQDPNDNTTVVPMDPGSSLSFDNHYFVNLKAHQGMFTSDATLLTNGRAANIVDKLQDPGVFFDTFKNSIKR
MGQIGVLTGANGQIRNKCNVVN

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from phytozome (Large 5' end is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ACAGGCGGGCACACGATCGGCGTCGGGAACTGCAACCTGTTCAGCTCGAGGCTCTTCAACTTCACCGGCAAGAACAACCCCAGCGACATCGACCCCTCCCTCAACCCCTCCTACGCCAAG
TTCCTCCAG
AGGTCTTGTACTTCTCCTGACCACTGTTCACATTTCTGTGCTTGCAAAACGACACATCTTCCTTCGCAATAAAAAGCAAAGAAAAGAAAAAAAACGCGGCACATCTTAGCA
ACAGATATCTATATGTATATATACATCATGTGCGCAGGGGCAGTGCCGGCGCAACCTGCAGGACCCGAACGACAACACGACGGTGGTGCCCATGGACCCCGGCAGCAGCCTCTCCTTCGA
CAACCACTACTTCGTCAACCTCAAGGCGCACCAGGGCATGTTCACCTCCGACGCCACGCTGCTCACCAACGGCCGCGCCGCCAACATCGTCGACAAGCTGCAGGACCCAGGCGTCTTCTT
CGACACCTTCAAGAACTCCATCAAGCGCATGGGGCAGATCGGCGTGCTCACCGGCGCCAACGGCCAGATCAGGAACAAGTGCAACGTCGTCAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ACAGGCGGGCACACGATCGGCGTCGGGAACTGCAACCTGTTCAGCTCGAGGCTCTTCAACTTCACCGGCAAGAACAACCCCAGCGACATCGACCCCTCCCTCAACCCCTCCTACGCCAAG
TTCCTCCAG
GGGCAGTGCCGGCGCAACCTGCAGGACCCGAACGACAACACGACGGTGGTGCCCATGGACCCCGGCAGCAGCCTCTCCTTCGACAACCACTACTTCGTCAACCTCAAGGCG
CACCAGGGCATGTTCACCTCCGACGCCACGCTGCTCACCAACGGCCGCGCCGCCAACATCGTCGACAAGCTGCAGGACCCAGGCGTCTTCTTCGACACCTTCAAGAACTCCATCAAGCGC
ATGGGGCAGATCGGCGTGCTCACCGGCGCCAACGGCCAGATCAGGAACAAGTGCAACGTCGTCAAC

Retrieve as FASTA