Entry information : SiPrx28 (Si006869m)
Entry ID 9526
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiPrx28 (Si006869m)
Name (synonym) SiPrx28 (Si006869m)
Class Class III peroxidase    [Orthogroup: Prx092]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx28
start..stop
S start..stop
SiPrx41 669 0 1..331 1..332
SiPrx40 548 0 1..330 1..327
ZmPrx117 486 1.13e-174 1..329 1..323
SbPrx133 457 3.56e-163 1..330 1..329
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '9526' 'complement(join(25892487..25893251,25893368..25893592))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 25893368..25893592 223 N° 2 25892487..25893251 763  
complement(join(25892487..25893251,25893368..25893592))


exon

Literature and cross-references SiPrx28 (Si006869m)
DNA ref. Phytozome 12:   scaffold_4 (25893592..25892487)
Protein sequence: SiPrx28 (Si006869m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   330 (306)
PWM (Da):   %s   35880.71 (33224.3)  
PI (pH):   %s   5.08 (4.96) Peptide Signal:   %s   cut: 25 range:25-330
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSPSRIASWLVPVILSVLVACTVANGDHRLSISYYDKSCPSVQSIVQSVMASRVAADQAIAPAVLRLFFHDCFVNGCDASVLLDDDGRHFFESEKAAEPNDSLRGFDVIDEIKSHLEHSC
PATVSCADILALASRDAVALLGGPAWNVQLGRKDSRAADKYAAMTELPSPKDNLTALVQLFERYGLDAKDLVALSGAHSVGTARCLHYRERVYGYDGQGGADDIDPSFAEIRRQTCQAGG
DDAMAPFDEQTPMRFDNAYYKDLIARRGLLTSDQELYGCGGPLDHLVERYSMDGEAFAKDFAKAMVKMGKIPPPPGKPVEVRLTCSKVNY*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGCCGTCGAGGATCGCTTCTTGGCTTGTCCCGGTGATCCTCTCTGTTCTTGTCGCGTGCACCGTCGCTAACGGTGACCACCGGCTCTCAATCAGCTACTACGACAAGTCCTGCCCC
AGCGTGCAGAGCATCGTGCAGTCCGTGATGGCGTCCAGGGTCGCCGCCGACCAGGCGATTGCCCCCGCAGTGCTCCGCCTCTTCTTCCACGACTGCTTCGTCAAC
GTACGTTGTCTCTAC
TTCTTCACTGATGTTTTTCAACTAATCTAATCTCTAGCTAGCTCGTGACTGCATCGCGGCTATGTTACCATATTAATTTGTCGGCCACGAATACATGACAGGGGGATGCGACGCCTCGGT
CCTCCTGGACGACGACGGCAGGCACTTCTTCGAGAGCGAGAAGGCCGCCGAGCCCAACGACTCGCTCCGCGGCTTCGACGTGATCGACGAGATCAAGTCCCACCTCGAGCACTCCTGCCC
GGCCACCGTCTCCTGCGCCGACATCCTCGCCCTGGCCTCCCGGGACGCCGTCGCCCTGCTCGGCGGCCCGGCATGGAACGTGCAGCTCGGCCGCAAGGACTCGCGCGCCGCCGACAAGTA
CGCGGCCATGACGGAGCTCCCCAGCCCGAAGGACAACCTCACCGCCCTCGTCCAGCTGTTCGAGAGGTACGGCCTCGACGCCAAGGACCTGGTCGCTCTCTCCGGCGCCCACAGCGTCGG
CACGGCGCGGTGCCTCCACTACAGGGAACGCGTCTACGGCTACGACGGCCAGGGCGGCGCCGACGACATCGACCCCTCGTTCGCGGAGATCCGCCGGCAGACGTGCCAGGCCGGCGGCGA
CGACGCCATGGCGCCGTTTGACGAGCAGACGCCGATGAGGTTTGACAACGCCTACTACAAGGACCTGATCGCACGGCGCGGCCTTCTCACCTCCGACCAGGAGCTCTACGGCTGCGGTGG
CCCGCTGGACCATCTGGTGGAGAGGTACAGCATGGATGGCGAGGCGTTCGCGAAGGACTTCGCCAAGGCCATGGTCAAAATGGGCAAAATTCCACCACCACCGGGGAAGCCGGTGGAGGT
GAGACTCACCTGCAGTAAGGTCAACTAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGCCGTCGAGGATCGCTTCTTGGCTTGTCCCGGTGATCCTCTCTGTTCTTGTCGCGTGCACCGTCGCTAACGGTGACCACCGGCTCTCAATCAGCTACTACGACAAGTCCTGCCCC
AGCGTGCAGAGCATCGTGCAGTCCGTGATGGCGTCCAGGGTCGCCGCCGACCAGGCGATTGCCCCCGCAGTGCTCCGCCTCTTCTTCCACGACTGCTTCGTCAAC
GGATGCGACGCCTCG
GTCCTCCTGGACGACGACGGCAGGCACTTCTTCGAGAGCGAGAAGGCCGCCGAGCCCAACGACTCGCTCCGCGGCTTCGACGTGATCGACGAGATCAAGTCCCACCTCGAGCACTCCTGC
CCGGCCACCGTCTCCTGCGCCGACATCCTCGCCCTGGCCTCCCGGGACGCCGTCGCCCTGCTCGGCGGCCCGGCATGGAACGTGCAGCTCGGCCGCAAGGACTCGCGCGCCGCCGACAAG
TACGCGGCCATGACGGAGCTCCCCAGCCCGAAGGACAACCTCACCGCCCTCGTCCAGCTGTTCGAGAGGTACGGCCTCGACGCCAAGGACCTGGTCGCTCTCTCCGGCGCCCACAGCGTC
GGCACGGCGCGGTGCCTCCACTACAGGGAACGCGTCTACGGCTACGACGGCCAGGGCGGCGCCGACGACATCGACCCCTCGTTCGCGGAGATCCGCCGGCAGACGTGCCAGGCCGGCGGC
GACGACGCCATGGCGCCGTTTGACGAGCAGACGCCGATGAGGTTTGACAACGCCTACTACAAGGACCTGATCGCACGGCGCGGCCTTCTCACCTCCGACCAGGAGCTCTACGGCTGCGGT
GGCCCGCTGGACCATCTGGTGGAGAGGTACAGCATGGATGGCGAGGCGTTCGCGAAGGACTTCGCCAAGGCCATGGTCAAAATGGGCAAAATTCCACCACCACCGGGGAAGCCGGTGGAG
GTGAGACTCACCTGCAGTAAGGTCAACTAT

Retrieve as FASTA