Entry information : SiPrx34 (Si006919m)
Entry ID 9532
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-12-14 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-12-07 (Qiang Li)
Peroxidase information: SiPrx34 (Si006919m)
Name (synonym) SiPrx34 (Si006919m)
Class Class III peroxidase    [Orthogroup: Prx028]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx34
start..stop
S start..stop
SbPrx136 543 0 2..325 5..329
ZmPrx106 524 0 30..325 32..323
OsPrx88 489 2e-176 20..325 17..318
BdiPrx25 489 2e-176 3..325 2..322
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 28498732..28498953 222 N° 2 28498417..28498608 192 N° 3 28497773..28498331 559  
complement(join(28497773..28498331,28498417..28498608,28498732..28498953))


exon

Literature and cross-references SiPrx34 (Si006919m)
DNA ref. Phytozome 12:   scaffold_4 (28498953..28497773)
Protein sequence: SiPrx34 (Si006919m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   325 (300)
PWM (Da):   %s   33667.79 (31242.4) Transmb domain:   %s   i5-27o
PI (pH):   %s   8.48 (8.39) Peptide Signal:   %s   cut: 26 range:26-325
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAATVRCLLTIAVVLAPFLAGATAGGPLSTSFYSKKCPNVQGIVRAGVASAVAAERRMGASILRMFFHDCFVNGCDGSILLDDTSTFTGEKNAGPNANSVRGFEVIDAIKAQVEAACNATVSCADILALAARDAVNLLGGPTWTVYLGRRDALTASQSDANAKPPRSGLQPxATLVAMFGNKGLSPRDMTALSGAHTVGQARCATFRDRIYNDANINATFASLRQQTCPQAAGGASDAALAPIDAQTPEAFDNAYYTNLMGKRGLFHSDQELFNGGSQDVLVKKYSGNAGMFAADFAKAMMRMGAISPLTGAQGEVRLNCRKVN

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGCGGCTGCAACGGTGAGGTGCTTGCTGACGATCGCCGTGGTGCTGGCTCCCTTCCTCGCCGGCGCCACCGCGGGCGGGCCGCTGTCGACGAGCTTCTACAGCAAGAAGTGCCCGAACGT
GCAGGGCATCGTGCGGGCGGGGGTGGCGTCCGCCGTGGCTGCGGAGAGGCGCATGGGCGCGTCCATCCTCCGCATGTTCTTCCACGACTGCTTCGTCAATGT
AAGAGCTAGCAATGTATT
TATTGCGTTGGGTCTGTCGTCATCGGTTTAAATTCCGATGCATGCATATTGCATCTGCTGCCTTACCAGAGTACTGTGCTGATCTGAAAGAGCATGGGCGCAGGGCTGCGACGGCTCGAT
CCTGCTGGACGACACGTCGACCTTCACCGGCGAGAAGAACGCCGGGCCCAACGCCAACTCGGTGCGCGGCTTCGAGGTCATCGACGCCATCAAGGCCCAGGTCGAGGCTGCCTGTAACGC
CACCGTCTCCTGCGCCGACATCCTCGCCCTCGCCGCCCGGGACGCCGTCAACCTCGT
ACGTCTCCGTTCACATCAACCGCATCGATCATCGATCTTGCTGGCAATATGCAATGCAAGTTA
CATCCATAATTAATGCACAGCTCGGCGGGCCGACGTGGACGGTCTACCTCGGCCGCCGCGACGCGCTGACGGCGAGCCAGAGCGACGCCAACGCCAAACCTCCCCGGTCCGGGCTCCAGC
CTCNNGCGACGCTCGTCGCCATGTTCGGGAACAAGGGCCTCTCGCCGCGCGACATGACGGCGCTCTCCGGCGCGCACACCGTCGGGCAGGCCCGGTGCGCCACGTTCCGGGACCGCATCT
ACAACGACGCCAACATCAACGCCACGTTCGCGTCGCTCCGGCAGCAGACGTGCCCGCAGGCCGCCGGCGGCGCCAGCGACGCCGCGCTGGCGCCCATCGACGCGCAGACCCCCGAGGCGT
TCGACAACGCCTACTACACGAACCTGATGGGCAAGAGGGGGCTGTTCCACTCCGACCAGGAGCTCTTCAACGGCGGGTCCCAGGACGTGCTGGTGAAGAAGTACAGCGGCAACGCCGGGA
TGTTCGCGGCCGACTTCGCCAAGGCCATGATGAGGATGGGCGCCATCAGCCCGCTCACGGGGGCGCAGGGCGAGGTCAGGCTCAACTGCAGGAAGGTCAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGCGGCTGCAACGGTGAGGTGCTTGCTGACGATCGCCGTGGTGCTGGCTCCCTTCCTCGCCGGCGCCACCGCGGGCGGGCCGCTGTCGACGAGCTTCTACAGCAAGAAGTGCCCGAACGT
GCAGGGCATCGTGCGGGCGGGGGTGGCGTCCGCCGTGGCTGCGGAGAGGCGCATGGGCGCGTCCATCCTCCGCATGTTCTTCCACGACTGCTTCGTCAATGT
CTGCGACGGCTCGATCCT
GCTGGACGACACGTCGACCTTCACCGGCGAGAAGAACGCCGGGCCCAACGCCAACTCGGTGCGCGGCTTCGAGGTCATCGACGCCATCAAGGCCCAGGTCGAGGCTGCCTGTAACGCCAC
CGTCTCCTGCGCCGACATCCTCGCCCTCGCCGCCCGGGACGCCGTCAACCTCGT
CGGCGGGCCGACGTGGACGGTCTACCTCGGCCGCCGCGACGCGCTGACGGCGAGCCAGAGCGACGC
CAACGCCAAACCTCCCCGGTCCGGGCTCCAGCCTCNNGCGACGCTCGTCGCCATGTTCGGGAACAAGGGCCTCTCGCCGCGCGACATGACGGCGCTCTCCGGCGCGCACACCGTCGGGCA
GGCCCGGTGCGCCACGTTCCGGGACCGCATCTACAACGACGCCAACATCAACGCCACGTTCGCGTCGCTCCGGCAGCAGACGTGCCCGCAGGCCGCCGGCGGCGCCAGCGACGCCGCGCT
GGCGCCCATCGACGCGCAGACCCCCGAGGCGTTCGACAACGCCTACTACACGAACCTGATGGGCAAGAGGGGGCTGTTCCACTCCGACCAGGAGCTCTTCAACGGCGGGTCCCAGGACGT
GCTGGTGAAGAAGTACAGCGGCAACGCCGGGATGTTCGCGGCCGACTTCGCCAAGGCCATGATGAGGATGGGCGCCATCAGCCCGCTCACGGGGGCGCAGGGCGAGGTCAGGCTCAACTG
CAGGAAGGTCAAC

Retrieve as FASTA