Entry information : SiPrx40 (Si008158m)
Entry ID 9538
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiPrx40 (Si008158m)
Name (synonym) SiPrx40 (Si008158m)
Class Class III peroxidase    [Orthogroup: Prx092]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx40
start..stop
S start..stop
SiPrx28 525 0 1..327 1..330
SiPrx41 522 0 1..327 1..331
SbPrx133 478 2.16e-171 1..327 1..329
ZmPrx117 475 2.67e-170 1..326 1..323
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '9538' 'complement(join(25968670..25969446,25969561..25969782))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 25969561..25969782 220 N° 2 25968670..25969446 775  
complement(join(25968670..25969446,25969561..25969782))


exon

Literature and cross-references SiPrx40 (Si008158m)
DNA ref. Phytozome 12:   scaffold_4 (25969782..25968670)
Protein sequence: SiPrx40 (Si008158m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   333 (308)
PWM (Da):   %s   36072.54 (33325.1)  
PI (pH):   %s   5.2 (4.96) Peptide Signal:   %s   cut: 26 range:26-333
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSPSRSSSWLTPLILSVLFACTANGDHHLSVRYYDETCPSAQHIVHSVMASKVAADQAIAPAVLRLFFHDCFINGCDGSVLLDDGTPFFESEKAAEPNDSLRGFDVIDEIKSHLEHSCPA
TVSCADILALASRDAVALLGGPAWSVQLGRKDSRGADRDAAENDLPSPHANLTGLIAAFAEHGLDARDMVALSGAHTVGTARCVHYKARVYGREEGGRADIDPSFAELRRQTCQGDGDDA
AAPFDEQTPMRFDNAYYKDLVARRGLLTSDQALYGCGGPLDHLVEMYSKDGEAFAYDFAKAMVKMGDIPPPPGMPVEVRLKCSMVNYRRTNRK*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCACCGTCGAGGAGCTCTTCTTGGCTTACTCCGCTGATCCTCTCTGTCCTTTTCGCATGCACCGCCAATGGTGACCACCACCTCTCGGTCCGCTACTACGACGAGACGTGCCCGAGC
GCGCAGCACATCGTGCACTCCGTGATGGCGTCCAAGGTCGCCGCCGACCAGGCGATAGCCCCCGCCGTTCTCCGCCTCTTCTTCCACGACTGCTTCATAAAC
GTACGTCTTGGTTTAGCT
CGATTATCTAGTCATCTTTCATGCTAGTAATCGTTATTACGTAATTAAGCTGTCCATTGCAATTAGCGACAGTAATTTTTCGAACGAATTGAACAGGGGGGTGCGACGGCTCCGTCCTCC
TGGACGACGGCACGCCCTTCTTCGAGAGCGAGAAGGCCGCCGAGCCCAACGACTCTCTCCGCGGCTTCGACGTGATCGACGAGATCAAGTCCCACCTCGAGCACTCCTGCCCGGCCACCG
TCTCCTGTGCCGACATCCTCGCCCTGGCCTCCCGGGATGCCGTCGCCCTGCTCGGAGGCCCGGCATGGAGTGTGCAGCTCGGCCGCAAGGACTCGCGTGGCGCCGACAGGGACGCCGCCG
AGAACGACCTCCCGTCCCCGCACGCCAACCTCACAGGCCTCATCGCCGCGTTCGCCGAACACGGCCTCGACGCCCGCGACATGGTCGCGCTCTCGGGCGCGCACACCGTTGGCACGGCGC
GGTGCGTCCACTACAAGGCCCGCGTCTACGGCCGGGAGGAGGGCGGCCGCGCCGACATCGACCCCTCCTTCGCGGAGCTCCGAAGGCAGACGTGCCAGGGCGACGGCGACGATGCCGCGG
CGCCGTTCGACGAGCAGACACCGATGAGGTTCGACAACGCCTACTACAAGGACCTGGTCGCGCGGCGCGGCCTCCTCACCTCCGACCAGGCGCTCTACGGCTGCGGTGGGCCGCTGGACC
ATCTGGTGGAGATGTACAGCAAGGATGGCGAGGCGTTCGCCTACGACTTTGCCAAGGCTATGGTGAAGATGGGGGACATACCGCCTCCGCCAGGAATGCCAGTGGAAGTGAGGCTCAAGT
GCTCGATGGTGAATTATCGAAGAACTAATAGAAAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCACCGTCGAGGAGCTCTTCTTGGCTTACTCCGCTGATCCTCTCTGTCCTTTTCGCATGCACCGCCAATGGTGACCACCACCTCTCGGTCCGCTACTACGACGAGACGTGCCCGAGC
GCGCAGCACATCGTGCACTCCGTGATGGCGTCCAAGGTCGCCGCCGACCAGGCGATAGCCCCCGCCGTTCTCCGCCTCTTCTTCCACGACTGCTTCATAAAC
GGGTGCGACGGCTCCGTC
CTCCTGGACGACGGCACGCCCTTCTTCGAGAGCGAGAAGGCCGCCGAGCCCAACGACTCTCTCCGCGGCTTCGACGTGATCGACGAGATCAAGTCCCACCTCGAGCACTCCTGCCCGGCC
ACCGTCTCCTGTGCCGACATCCTCGCCCTGGCCTCCCGGGATGCCGTCGCCCTGCTCGGAGGCCCGGCATGGAGTGTGCAGCTCGGCCGCAAGGACTCGCGTGGCGCCGACAGGGACGCC
GCCGAGAACGACCTCCCGTCCCCGCACGCCAACCTCACAGGCCTCATCGCCGCGTTCGCCGAACACGGCCTCGACGCCCGCGACATGGTCGCGCTCTCGGGCGCGCACACCGTTGGCACG
GCGCGGTGCGTCCACTACAAGGCCCGCGTCTACGGCCGGGAGGAGGGCGGCCGCGCCGACATCGACCCCTCCTTCGCGGAGCTCCGAAGGCAGACGTGCCAGGGCGACGGCGACGATGCC
GCGGCGCCGTTCGACGAGCAGACACCGATGAGGTTCGACAACGCCTACTACAAGGACCTGGTCGCGCGGCGCGGCCTCCTCACCTCCGACCAGGCGCTCTACGGCTGCGGTGGGCCGCTG
GACCATCTGGTGGAGATGTACAGCAAGGATGGCGAGGCGTTCGCCTACGACTTTGCCAAGGCTATGGTGAAGATGGGGGACATACCGCCTCCGCCAGGAATGCCAGTGGAAGTGAGGCTC
AAGTGCTCGATGGTGAATTATCGAAGAACTAATAGAAAA

Retrieve as FASTA