Entry information : SiPrx41 (Si008174m)
Entry ID 9539
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiPrx41 (Si008174m)
Name (synonym) SiPrx41 (Si008174m)
Class Class III peroxidase    [Orthogroup: Prx085]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx41
start..stop
S start..stop
SiPrx28 642 0 1..331 1..330
SiPrx40 545 0 1..331 1..327
ZmPrx117 483 2e-173 1..330 1..323
SbPrx133 453 1e-161 1..331 1..329
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 25846706..25846933 228 N° 2 25845825..25846589 765  
complement(join(25845825..25846589,25846706..25846933))


exon

Literature and cross-references SiPrx41 (Si008174m)
DNA ref. Phytozome 12:   scaffold_4 (25846933..25845825)
Protein sequence: SiPrx41 (Si008174m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   332 (306)
PWM (Da):   %s   35953.72 (33210.2)  
PI (pH):   %s   5.08 (4.96) Peptide Signal:   %s   cut: 26 range:26-331
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSPSRIASWLAPLILSAVLLSCTVANGDHRLSVSYYDKSCPSVQSIVQSVMASRVAADQAIAPAVLRLFFHDCFVNGCDASVLLDDDGRHFFESEKAAEPNDSLRGFDVIDEIKSHLEHSCPATVSCADILALASRDAVALLGGPAWNVQLGRKDSRAADKYAAMTELPSPKDNLTALVQLFERYGLDAKDLVALSGAHSVGTARCLHYRERVYGYDGQGGADDIDPSFAEIRRQTCQAGGDDAMAPFDEQTPMRFDNAYYKDLIARRGLLTSDQELYGCGGPLDHLVERYSMDGEAFAKDFAKAMVKMGKIPPPPGKPVEVRLTCSKVNY*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGCCGTCGAGGATAGCTTCTTGGCTTGCTCCGCTGATCCTGTCTGCAGTGCTTCTCTCGTGCACCGTCGCCAACGGTGACCACCGTCTCTCCGTCAGCTACTACGACAAGTCCTGC
CCCAGCGTGCAGAGCATCGTCCAGTCCGTGATGGCGTCCAGGGTCGCCGCCGACCAGGCGATTGCCCCCGCAGTGCTCCGCCTCTTCTTCCACGACTGCTTCGTCAAC
GTACGTTGTCTC
TACTTCTTCACTGATCTTTTTCAACTAATCTAATCTCTAGCTAGCTCGTGACTGCATCGCGGCTATGTTACCATATTAATTTGTCGGCCACGAATACATGACAGGGATGCGACGCCTCGG
TCCTCCTGGACGACGACGGCAGGCACTTCTTCGAGAGCGAGAAGGCCGCCGAGCCCAACGACTCGCTCCGCGGCTTCGACGTGATCGACGAGATCAAGTCCCACCTCGAGCACTCCTGCC
CGGCCACCGTCTCCTGCGCCGACATCCTCGCCCTGGCCTCCCGGGACGCCGTCGCCCTGCTCGGCGGCCCGGCATGGAACGTGCAGCTCGGCCGCAAGGACTCGCGCGCCGCCGACAAGT
ATGCGGCCATGACGGAGCTCCCCAGCCCGAAGGACAACCTCACCGCCCTCGTCCAGCTGTTCGAGAGGTACGGCCTCGACGCCAAGGACCTGGTCGCTCTCTCCGGCGCCCACAGCGTCG
GCACGGCGCGGTGCCTCCACTACAGGGAACGCGTCTACGGCTACGACGGCCAGGGCGGCGCCGACGACATCGACCCCTCGTTCGCGGAGATCCGCCGGCAGACGTGCCAGGCCGGCGGCG
ACGACGCCATGGCGCCGTTCGACGAGCAGACGCCGATGAGGTTTGACAACGCCTACTACAAGGACCTGATCGCACGGCGCGGCCTTCTCACCTCCGACCAGGAGCTCTACGGCTGCGGTG
GCCCGCTGGACCATCTGGTGGAGAGGTACAGCATGGATGGCGAGGCGTTCGCGAAGGACTTCGCCAAGGCCATGGTCAAAATGGGCAAAATTCCACCACCACCGGGGAAGCCGGTGGAGG
TGAGACTCACCTGCAGTAAGGTCAACTAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGCCGTCGAGGATAGCTTCTTGGCTTGCTCCGCTGATCCTGTCTGCAGTGCTTCTCTCGTGCACCGTCGCCAACGGTGACCACCGTCTCTCCGTCAGCTACTACGACAAGTCCTGC
CCCAGCGTGCAGAGCATCGTCCAGTCCGTGATGGCGTCCAGGGTCGCCGCCGACCAGGCGATTGCCCCCGCAGTGCTCCGCCTCTTCTTCCACGACTGCTTCGTCAAC
GGATGCGACGCC
TCGGTCCTCCTGGACGACGACGGCAGGCACTTCTTCGAGAGCGAGAAGGCCGCCGAGCCCAACGACTCGCTCCGCGGCTTCGACGTGATCGACGAGATCAAGTCCCACCTCGAGCACTCC
TGCCCGGCCACCGTCTCCTGCGCCGACATCCTCGCCCTGGCCTCCCGGGACGCCGTCGCCCTGCTCGGCGGCCCGGCATGGAACGTGCAGCTCGGCCGCAAGGACTCGCGCGCCGCCGAC
AAGTATGCGGCCATGACGGAGCTCCCCAGCCCGAAGGACAACCTCACCGCCCTCGTCCAGCTGTTCGAGAGGTACGGCCTCGACGCCAAGGACCTGGTCGCTCTCTCCGGCGCCCACAGC
GTCGGCACGGCGCGGTGCCTCCACTACAGGGAACGCGTCTACGGCTACGACGGCCAGGGCGGCGCCGACGACATCGACCCCTCGTTCGCGGAGATCCGCCGGCAGACGTGCCAGGCCGGC
GGCGACGACGCCATGGCGCCGTTCGACGAGCAGACGCCGATGAGGTTTGACAACGCCTACTACAAGGACCTGATCGCACGGCGCGGCCTTCTCACCTCCGACCAGGAGCTCTACGGCTGC
GGTGGCCCGCTGGACCATCTGGTGGAGAGGTACAGCATGGATGGCGAGGCGTTCGCGAAGGACTTCGCCAAGGCCATGGTCAAAATGGGCAAAATTCCACCACCACCGGGGAAGCCGGTG
GAGGTGAGACTCACCTGCAGTAAGGTCAACTAT

Retrieve as FASTA