Entry information : SiPrx44 (Si008457m)
Entry ID 9542
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiPrx44 (Si008457m)
Name (synonym) SiPrx44 (Si008457m)
Class Class III peroxidase    [Orthogroup: Prx147]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx44
start..stop
S start..stop
SbPrx140 505 0 2..320 1..317
ZmPrx134 468 7e-168 25..320 22..320
OsPrx92 452 6e-162 2..320 1..314
OsPrx93 450 5e-161 2..320 1..314
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 37043631..37043858 228 N° 2 37043974..37044171 198 N° 3 37044276..37044435 160 N° 4 37044597..37044970 374
join(37043631..37043858,37043974..37044171,37044276..37044435,37044597..37044970 )


exon

Literature and cross-references SiPrx44 (Si008457m)
DNA ref. Phytozome 12:   scaffold_4 (37043631..37044970)
Protein sequence: SiPrx44 (Si008457m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   321 (300)
PWM (Da):   %s   34227.73 (31817.5)  
PI (pH):   %s   5.14 (4.96) Peptide Signal:   %s   cut: 21 range:21-320
Sequence 362
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MMRRLQFLATASFFLLAIDAFPPSMAGAQQLSPDHYADVCPNLESIVRAAVRMSVAHSPVAAPATLRLFFHDCAVRGCDASIMLINPDGDDEWRSLDGMTLKLEGFNTVMSAKAAVDSDPRCRNMVSCADILALAARDSVFLSGGPDYLVELGRYDGRVSTQGSVLIPHGNFNLDQLNAFFSGLGLSQADMIALSGAHTIGAASCGVFGYRLGTDAAMDPAFAEQLRGSCPGAGGFAFLDAATPLRFDNEYYRNLRGGRGLLASDQALYADPRSRGAVDRYAADQGAFFGDFAASMTRLGRVGVRTADDGEIRRDCRFPN*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from phytozome (5' end is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGATGAGGCGCCTCCAGTTCTTGGCCACCGCCTCCTTCTTCCTCCTCGCAATCGATGCCTTCCCGCCGTCAATGGCCGGGGCCCAGCAGCTGTCGCCGGACCACTACGCCGACGTCTGCC
CCAACCTCGAGAGCATTGTCCGCGCCGCCGTGCGGATGTCCGTGGCGCACTCGCCGGTCGCCGCGCCCGCCACGCTCCGGCTCTTCTTCCATGACTGCGCTGTCAGG
GTACGTTCGTTCG
GTTTCTGACGTTATGTATGCCGATGGATCAGTTGACCTACGAATCAACTGGTGAGATTATTGGCTTGTGATTGTTTGTTGATGCCGTGCGATCCTCATTAAGGGCTGCGACGCGTCGATC
ATGCTCATCAACCCCGATGGCGACGACGAGTGGCGGAGCCTCGACGGCATGACGCTGAAGCTTGAGGGGTTCAACACGGTGATGAGCGCCAAGGCGGCCGTGGACAGCGACCCGCGGTGC
CGGAACATGGTGTCGTGCGCCGACATCCTGGCACTCGCCGCCAGGGACTCCGTGTTCCTG
GTAAGCACGACACCATCCTTGCCGCTCGCGTTCGCGCTCGAGGGCGTTCATTTGTCTCGC
CGGATCGTGACCGTGTCTCGCGTGAACACACGGCGGCCGCGCAGAGCGGAGGGCCGGACTACCTGGTGGAGCTGGGCCGGTACGACGGCCGGGTGTCGACTCAAGGCAGCGTCCTGATCC
CTCATGGCAACTTCAACCTCGACCAGCTCAACGCCTTCTTCTCCGGCCTCGGCCTCTCCCAAGCCGACATGATCGCGCTCTCAG
GTATACCTAGAATTGCACGTGTACATATCAATATGT
CACAGCTATATCTGCTAGCTAGAACACGCCAAGATCATGCACACGCAGCATTTACTTGCGAGACTGGTGGTGTCGTCGTGTCCTGTTGCTAACTGCCGTTCTTGCATGTGGGCATCGCAA
AGCAGGGGCTCACACGATCGGCGCGGCGTCGTGCGGCGTCTTCGGGTACCGGCTGGGCACGGACGCGGCCATGGACCCGGCGTTCGCGGAGCAGCTCCGGGGCAGCTGCCCGGGCGCCGG
CGGTTTCGCGTTCCTTGACGCCGCGACGCCGCTGCGGTTCGACAACGAGTACTACCGGAACCTGCGCGGCGGGAGGGGGCTCCTGGCGTCCGACCAGGCGCTGTACGCGGACCCGAGGTC
GCGCGGCGCCGTCGACCGCTACGCCGCGGACCAGGGCGCCTTCTTCGGCGACTTCGCCGCGTCCATGACCAGGCTCGGCAGGGTCGGGGTCAGGACGGCGGACGACGGCGAGATACGCCG
CGACTGCAGGTTCCCCAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGATGAGGCGCCTCCAGTTCTTGGCCACCGCCTCCTTCTTCCTCCTCGCAATCGATGCCTTCCCGCCGTCAATGGCCGGGGCCCAGCAGCTGTCGCCGGACCACTACGCCGACGTCTGCC
CCAACCTCGAGAGCATTGTCCGCGCCGCCGTGCGGATGTCCGTGGCGCACTCGCCGGTCGCCGCGCCCGCCACGCTCCGGCTCTTCTTCCATGACTGCGCTGTCAGG
GGCTGCGACGCGT
CGATCATGCTCATCAACCCCGATGGCGACGACGAGTGGCGGAGCCTCGACGGCATGACGCTGAAGCTTGAGGGGTTCAACACGGTGATGAGCGCCAAGGCGGCCGTGGACAGCGACCCGC
GGTGCCGGAACATGGTGTCGTGCGCCGACATCCTGGCACTCGCCGCCAGGGACTCCGTGTTCCTG
AGCGGAGGGCCGGACTACCTGGTGGAGCTGGGCCGGTACGACGGCCGGGTGTCGA
CTCAAGGCAGCGTCCTGATCCCTCATGGCAACTTCAACCTCGACCAGCTCAACGCCTTCTTCTCCGGCCTCGGCCTCTCCCAAGCCGACATGATCGCGCTCTCAG
GGGCTCACACGATCG
GCGCGGCGTCGTGCGGCGTCTTCGGGTACCGGCTGGGCACGGACGCGGCCATGGACCCGGCGTTCGCGGAGCAGCTCCGGGGCAGCTGCCCGGGCGCCGGCGGTTTCGCGTTCCTTGACG
CCGCGACGCCGCTGCGGTTCGACAACGAGTACTACCGGAACCTGCGCGGCGGGAGGGGGCTCCTGGCGTCCGACCAGGCGCTGTACGCGGACCCGAGGTCGCGCGGCGCCGTCGACCGCT
ACGCCGCGGACCAGGGCGCCTTCTTCGGCGACTTCGCCGCGTCCATGACCAGGCTCGGCAGGGTCGGGGTCAGGACGGCGGACGACGGCGAGATACGCCGCGACTGCAGGTTCCCCAAC

Retrieve as FASTA