Entry information : SiPrx52 (Si010547m)
Entry ID 9548
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-12-12 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-12-07 (Qiang Li)
Peroxidase information: SiPrx52 (Si010547m)
Name (synonym) SiPrx52 (Si010547m)
Class Class III peroxidase    [Orthogroup: Prx154]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx52
start..stop
S start..stop
SbPrx92 554 0 32..336 35..345
BdiPrx129 518 0 33..336 30..333
OsPrx55 510 0 35..335 35..335
TaPrx186-1B 495 3.71e-178 38..336 34..335
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '9548' 'complement(join(22204491..22205369,22213490..22213507,22386742..22386756,22738836..22738865))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 22738836..22738865 28 N° 2 22386742..22386756 13 N° 3 22213490..22213507 16 N° 4 22204491..22205369 877
complement(join(22204491..22205369,22213490..22213507,22386742..22386756,2273883 6..22738865))


exon

Literature and cross-references SiPrx52 (Si010547m)
DNA ref. Phytozome 12:   scaffold_7 (22738865..22204491)
Protein sequence: SiPrx52 (Si010547m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   336 (314)
PWM (Da):   %s   35897.44 (33572.1)  
PI (pH):   %s   9.63 (9.12) Peptide Signal:   %s   cut: 23 range:23-336
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAGAPLRRRLLLPLALLAAAAAASCAAAAKAPRLSPNYYRRSCPRVERIVSDVIAAKQRANPSTAAGTLRLFFHDCFVNGCDASVLVSPLSSDASPERAAEINLSLPGDAFDAVDRAKAA
LEAACPGVVSCADILALAARDLVGILGGPRFPVALGRRDARRSDARDVEGNLPRTNMSARAMARLFASKGITPREMVALAGAHTVGFSHCGEFAHRIYGYRGAGGHDPRLNPEFALALQR
SCAGYRSDPTVSIFNDIVTPRDFDEAYYKNLPRGLGLLASDAALWEYPPTRVFAERYAGNRTAFFEDFAAAMQRLGAVGVKTGRQGVVRRRCDALD*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CGTCTTCTACTTCCATTTCTCCTCCTAGCCGTCGCTTCTGGCGCCTACGACGGCGATGGCCAGCCGCCGATTAGCCGGAGAAGCTTCCCTGAGGGGTTCATATTCGGGACATCTTCTGCT
TCCTACCAGGTGAAAGTTCTTCGCCATTCGTACTTAGCGATGCCCAATGCTCTTGTTTTTGATTTAGGTATAGTGCAGTGAGATCGTTTATGTTCCCTTTTGTCATCTCCTGTACAAAGT
TTTATATGATTGTTTATACAGGGTGTTTGACACAATGACACGCAGTTAAGGTGTAGCATATTCTGCCAAATAAATGGATGTGAACTGCAACATAATGTTCGCCACAAACATATACAGTAG
TTGGCAACAAATTAAATATAGTAACTAATCACTAGTAAAAATCAGCATAAAAGGTTCCACCACCTGTTCCAAGCAGTCATTGGCCTAACGATTTTTCATGGCGCTGTGTTTTGTTTTGGA
ATCGATCATATGAGCCATCTTGATGTTTACACATGCAGTATGAGGGTGGCGTGATGGAGGGGGGCAGGGGACCAAGCATCTGGGACACCTTCACTCATCAGCACCCAGGCATGTTTAAAC
CTATCTTTTGATCTCCAGTAAACTTGTATTTTTCAATTAGGGGCATTTGTGTTCTTGCCCCTGTTTTGAAGCGTAATCGTGATTTTGCTCTCATTTTTTCAACTTGGTGATTTTGCCCTC
GACTATTCACAAGTCAATGCGATTTTGCCCCTAGTCAATGGTCAAAACAGGGGCAAATACGTAAAGACCATAGTCAATGGTCAAAACAGGGGCAAATACGCAAAGACCAATGGCAAAATC
ACAATGACTTATGAATAGTTGAGGGCAAAATCACAAAAGTTAGAAAAATAAGGGTAAAAGCATAATTGCACTTCAAAGTAGGGGCAAGATCACCAAAAATCCTTTCAATTAAAACGACAA
GAAAAAATAGTTAGGGAATCATCTTTAAAACTTCTAACAATTTTCTGATATGGCAGATAAAATCATTGACAGAAGCAACGGGGATGTGGCTGTGGATTCTTACCATCTCTACAAAGTACG
TATAACTGTAGTAATATATTTAATCAGGTTTCCTTCTTTTTGATTAAATAATTCCTTCAACAATTTCAAGGAATCATATGCTCCAAGCTGTGCAGGCTCTTTAGTTCTGTCAGATTAAGA
TAATAAGCCCACGATATGATTTTTGAAGTTCCTCCAAACTACCAACAAAAAAAACATGTTAGTACACCATTGATCCATGGGAGGACTTGCCTCAAAAATGCAGGAAGATGTGCGCCTCAT
GAAGGATATGGGAATGGATGCATACAGGTTCTCCATCTCATGGACAAGAATACTTCCAAGTAAGTAACACTGCTGGAGAACCGATCTTTCGTATCGGTCAGTAACCCTCTTTAGTACAAG
GCGGTACCGCTTGTTTAGTACTGCGAGATACGTCGCGCTGTTGCGGACGGCAGTTTAGTACCAATTGGTAGTTTTACTACCCGATACTAAATGGTTATTCTTTTTTTTTCCTTTCATTTT
AATTTGTGAGTTGGTTAGTATTCGTATTAGTGTACCAAATGGTCAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAAAGTTTTTTAATTTACTTCTCCAT
TTGTAAAGCAACAAATATAAAAAACACTTTCTGAAAAACATTGCTGACCTTTTATATATGGACCACTTTCATCGAGCAAATTAAATCCCTACAAATTTTGTGGGGAATTTCGGCAGCAAC
TCCCTTTATCTCGAATCGTCGTTAGCTTGAGCTCAACTATGTTATTCATGTAAAGCAACAAAATTAGTTGATTATTTTGTTTCAACATTGTACTTATGTTATTTATGTAAAGCAACAAAA
GTAATTAACACAACACATATTTGTCAATAGCCAATACGAATTTCTCAATATCGAACAGACTTTCATAAGTAAAAATTCTACATTCTACATGNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNTCCAGGGGAATCTAGCTGTTGGCCATCCAATCCCCATGCCACCATTTAGTACCGGCTGAGGCTCCAAACTGGTATTACATGGGCTCCGATGGTATTGTGC
GTGACGATACCGGACGAAAAGACGTCTGGTACTAACGTGTTGGATGAATGCTCAGTTTTTCAGTAGTGTAATCTTTTGCTCAGACATTTTAGGTTGCACTGCCTTGGACAGATTCCAAAG
TCTAAGTAGATGGATAACACAAAACTTAGCTATCTGAATCTAATGACAGATGGAAGTATGAGCGGTGGAGTCGACAGAGAAGGCGTTAGATACTACAACAATTTGATCGATGAACTCTTG
TTGAAAGGTATCCCTGCATGTCTTGGTGCTTTGGATAGCCTCTTGCGATCCAATAGTATATAATGTTATGCATTTTATTGGCAGGGGTGCAACCATTTGTGACTCTTTTTCACTGGGACT
CACCTCAGGTATTAGAAGACAAATATGGAGGATTTCTTAGTCCTAATATCATGTGAGTCACGACCTTAGGCTTCTCTAGAGTTGTTTTTGCTATAGTCTTTTTGGTGAATATATTGTTTA
TCTGGAAGTTTGTTAATTACAAAAGTTTTGTCAGATTAATATTCATCCAGCACTCAAGAACTACACAACAAGTCCTCATAAAAACAGACACTTGTGCATTGACATTACCATCGTCGCAAT
AAAACTTCCTCCCTTTTTATGATTTTATCGTTCATGACTGCAACTGTTGCAGAAACGACTATAAGGACTACGCTGAAGTCTGCTTCAAAGAGTTTGGTGACCGAGTGAAACACTGGATCA
CGTTCAATGAACCCGGGGGCTTCTGTTCAGGAGGTTATGCATCTGGCGTGCTTGCACCAGGCCGATGCTCGCCATGGGAGCAGGGCAAGTGCAGCGCTGGGGACTCAGGAACGGAGCCTT
ACACTGTATGTCATCATCAACTACTCGCCCATGCAGAAACAGTGCGCTTATACAAAGAAAAATACCAGGTTAGTGACCAACTCTCCTTGCAATTGCAGTTCTTGAATGAACTGATTGGCA
CTGTGAAAAATTGAGCTTGATACATAAATCATGTTGAGAGTTCAGTTTTTGTCTAGGTCTACCATGGGGAAATGCAGTAGCTTGTTTAATTACGTAACTGGATCATATATATTCACTCTT
TTTTCTATTTTTAATCTGAAGCAGAAAGAGCTACTGCTGACCATATGTTCTGCGCTAATCTTCTAGTCTATGGATGTAAAGTCAGGAGCCGTACAGTTTAGTATGAGACATAATTATATA
AGCTGGTAGTTAGGGATCATGGTCTTGCATACACTGCAAGATTCAGAGTCGTTACCAAGAGTTTGTATTGTTAAATTATGAATAGCCGACTGTGAGTTAGTATTGCATTCCTCTATCAGT
TTTCATTCAGGGATTCTTGTTCGGTAAACATTAATCGCTGATTCTTTTTTAACTCCTGGCAAAGGCTCTTATATAGCACATTACCATTGCCCATTAATTAGTAAAATACCGAAGTCTGCC
GTCCCCGTCGACCACTTAAATGGATCTTTCTGCAGAGTCTGTGAATCTTATAGCGAAATCCCAATTCAGAATATCATTTCATATGAATGACACGAATAATATGTTGTATTTGCGAAATAA
ATTTCACTCTGACCATGATCTGGACTCATTGCTCATATTTGCATGCAGGCGATCCAGAAAGGGAAGATTGGAATATCATTAGTCTCACTTTGGTTTCTCCCTTCGTCCCCATCCAAATGC
AATGATAATGCAGTGAGACGTGCCTTAGATTTCACATTTGGATGGTAAATTCTCTATACAATTGTGACCACTCATAACTTTGTTCTTAAAGTTGAGGAAAAGAACACAAACCTTACTAGC
CATATACTCCTAGGTTCATGGACCCCCTTGTTAAAGGTGACTACCCGCTCAGCATGAAAGGACTGGTGGGAAATCGCTTGCCACAATTCACAAAACAACAATCTGAGACGATCAAGGGTG
CATTTGACTTCATCGGACTCAACTACTATACCACGTACTACGCTAGCTCTGCTAACAACCTTCCTCCAAATGGTCTTAACAAAAGCTATAACACGGATTCTCGTGCTAATCTTTCCGGTG
AGTCACCAAGCCACTGATCTTCTATTTTTTTTATCAGTCTAATATCGATGAAGTTCTCTTTCCTGAATCCGCCCAAGAGTGTTGTAGCGAAACTCCATACAACAATGGCTCTTATTTTAA
CAGTACTACTGTAGCATTTACGACAAGCATGCTGTTATGTCAACTGCAACCTCTACCCCTCAGTTGACTCCCAACTCTGAATAATTCTTATATACTATTTGAGATTTAGTTTCAAACTAT
AATTATTTGTAATACATTTTTCTGTCATCTTATGATTATATTAGGTGTTCGAAATGGTGTCCCCATAGGTCCTCAGGTATCTTATCATTTCCTAACATAGGAACGATATGTGATGGGTTT
TCTGCCCATTTTTATTATGTCTGTGATGACTTATAAATTTGCTTCACCAACATATATGTAGGCTGGTTCGCCTTGGCTCTACATGTACCCTCGAGGCTTTCGTGAGCTTCTACTTTATGT
TAAGGAAAACTATGGCAACCCTGCTATCTACATCACTGAAAACGGTAACTTTTAATCAATAAGTACTATCTTTATTGGCAGAGAGGGCGAACACTGTCATGCAGTGCCATTTATTTATTT
TGCAATGGATTCAGTATATTGCAGCAGTACTGCCACAACCTTTACTCTTGTTCATTTGTCGCTTTGGACACTGACACAGCCTTCAACAATTGACTTTAACCAAAATAATTCAGGTTTACA
AAGTATATAAACTATAGAGAACTGCTCCGGTCCTCCCTTTCTAAATGATTAGCATGCATCCCAAAGCACAATTAGAATTCTTATTATCATTTTCAATTAATGCGAGGATCTAGAATCCAG
CCCAACCCATCAGCTAGCCCAGCCCAGCCCAAGTCCACAAAACATGTTTTGTGTTAGCAGCGTTGCCACTCACGTCGTGCTGCGTGGACGTCTAGCTGCACCGCCGCCCCTGTGGTCGAA
GACTCCACCACCGTCTCCATCGACCAAGAGCGCTCCTCATCCACAGCTCTCTAAATAGAAACATCATCTCTTGCGGCACGCCCCTTGGCCTAAATGTCTGCACATCAGCCGCTTCCGCTA
CCATATTCATCCATTCCATGAGCCCAAAAACATCCCTTCCCGTGAGCTCATCTTGCCTTAATAGCTGGCGAGGCTGTGGATTTGATCTGTCGATGGTACGTAGTCGGTAGACGCGCAGGG
AGGAAATGAGGAATAGATTTGTCCAACAATCACTCATCCATGGACAAAGAAGATGATGGTGGCTATATAAAGATAATTTTTCCTTGATGATCTGGATGTTGATGACCCAAGTTCTGATTA
TTTGAGTTTGTCATTCGATCAATCCATGTTCTCCATCTGAGGAGAAAAATGTCAGCAGCTAGTTGAATCGATAATATGTTTCAATCATTTGTCATACTAGCTATAATTTTACGTGATTAG
GGTTCACTGGTACTTCTTGCCGCATATACATGCATGTGATTAGATCGTGTGTTTATTTGGATGGGCTGGGCTGGGCTGGATTGGACAAGTGAGGACCGGACCCAGGCAGGTATCAACAAG
TAAACATCATAAATAATATTCTTAATTAATTAAGTATGCTTTAGGATTTGTGCTGCTTTTTTTAAAAAAGGAGTACCGGAGCACTTCTCTAAACTATAACCATCTCATACTTTTTCAAAA
AAAAATCAATTAACACCAATTTTATGTGAGCAAACCTTCACTTTTGTGTATATGAGTGGTCAAAGTTTTATCTAAACTTTACTGCAATTCAAGCATTGCTTAAATGACACCCATTTGAGA
AAGAAGGGAGTATAACTTAGAATTTTCTCCTCTGATGTGTTTTTTTTAAATAAAAGCATTGGGGGAAAAGTTGAATTGAAACCATCTGAAAACATTTTTCTTAAGGCTTTGATGAAGCCA
ACAACATGAGCTTGCCACTCCATGAAGCCTTGAAGGACGACACTCGGATAGAGTACCACCACAAGCACCTCCTTGCCCTGCATAGTGCCATAAGGTCATCTCTCGAGCTAAATGACACAG
CACAGCCCATTGTTAGTAAAATTGAATATTTGTCTTCTTTTAATTCACAGGGATGGAGCAAACGTGAAAGGATACTTCGCATGGTCGCTGCTAGATAACTTCGAGTGGGCGTACGGCTAC
ACAGTCCGGTTCGGGCTAAACTTCGTGGACTACAACGACGGGTTGAAGCGGTACCCCAAGAACTCAGCCCATTGGTTCAAGGAGTTCCTGCACAAATGAACATGGAATGGAAGCTGCGTT
TGGAACGGTGCAAGATTACATTGGTGTACGTGGATTGATTTTGCGTAAGGCATGGCATGAAAGACATTGTGTTAAAACAAATGCATTCGCGTTTTGCTGCAACAAAGCATGGCTGCGTTG
GTCTGGTAATCAAGACAATGTGGACCTTCAGAGTTCAGTCGTAGGTATTGTGTTGTGTTTCGTAAAGAGAGGAAGAAACAATTCGTTCATATCCGTACAAATGAGACAAGGCTGAGGATA
AGTCGCTGCACGAGTGCCCGTAAAGGAACTATATCCACGTTCCTCTTCCTTGCAGCTGCATCAAACGACTCTGGAAGCCCTTGACCAAAACTTTGGTCGCCTAGCTAGCTTCAAGATAAA
CACGTCAACTTCCTCCAAAGTTGACCTCATCGCCTACATATTCCCGGATGCATCGCCGTGCACTTCATCACCTCACACCTCACAGTCACACAAGCTAGTAGTAGTAGTACAAGTGCCAGG
CATTCCTTCACCATGGCCAGCCACGCAGTCCTCCTACTGCTATCTTTCCAACTGATGATCACCAGGTCGCTCTNNNNNNNNNNNNNNNNNNNNAACCGAGACCTCCCGGCGCTGATCAAG
ATCAGGGAGCAGTTCGGCAACCCGGCCGTGCTGTCGGGCTGGCGGCCCGGCGGCACGGCCTGCGCCTGGCCCGTGTCCTGCAACGAGCAGGGCCGCGTGACCAAGATCTTCCTCACCAAC
TACAACATCACGTCCACGCTCCCGCCGGCCTTCGGCGAGCTCGACCAGCTGGAGACCCTCAGCATCATCAACATGCCGGGCCTGCACGGGCCCATCCCGGACACCTTCGGCAACCTCGCG
CACCTCTCCATCTTCAACCTCATGGTCACCTCTGTCTCGGGCCCCATCCCGTCCTCCCTCTCCCGCACCAACCTCACCTCCGTCAGCTTCCTCCGGAGCAAGCTCAACGGCACCATCCCG
AGGTCGCTGCGGCGGCTGCCGTACCTGACCTTCTTCGACGCCGCGCACAACGACCTCGAGGGGCCCATCCCGCCGCTGCTGGTGCGCGACAGCACGCCGGACCGGCCGCTGGGCCTGATG
CTGGACGGGAACCGGCTGTCCGGGACCATCCCCTGGACGTACGCGCTGGAGAGGAACTGGATGCAGTTCAGGGTGGCCAACAACAAGCTCACCGGGGACGCGTCGTTCCTCTTCGGCCGG
CGGAAGACGATGGCCGGGACCATGGACCTGTCCGGGAACAGGTTCAGGTTCAACCTGTCGGGGGTGGAGTTGCCCCAGCACCTGATGTTCCTCAACCTCAGCCACAACCGGATCTACGGC
GGCGTGCCGGCGTCGCTGCGGGAGTCGAAGGTGGCCGTGCTGGACCTCAGCTACAACCAGCTGTGCGGGGAGATACCCACCGGCGGGCATATGGTGCAGTTCAAGGCGGCGGCGTACGAG
CACAACAAGTGCCTGTGTGGGACGCCGCTGCCGCCCTGCGCCAACGGCAGCTGAGGTGACCCGAAGCTGTCGTTCTTGTCGTGTTATGTTCAGCTATTTCAAACTTGCTTNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCATGATACTCCCTCCGTCCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATACTGTATAATTTATACGAACAAGTGGGCTTG
TTCTAATATCATATATTTAAAAAATAAAGGAGGTAGACAAATAGAGTACAATACATATTAGTAAGGTATATATTTTGTGAAATTCTCTTCAACTTGAAATCCCTCAATGGCAAGCTTTCT
CATCATATTATAATGCTTGAAAGTTGAAACCATTGCATGTCTCAACTGCCTTATCATAGATCCTGGCCGGATTTGAATGTAATCATACCCATCATCTGAGTAATATATATGGTATGACTG
AATGACACCTGCAGGAGTCAAGAGTTCACCGTAGTTCTTGTGATGTCTTAGTTGATAGATCGTGCAAATTACTGATATCGAACATCACTTGTTATAAAATAGAATCTTTTGAGGGTTTGT
TTGGAGAGTAATATCAATGTCAGTTTTCTTTTTACGGTTGAACTTGGGGTGAGCACACATTCCTTCAGCTACGGGCTTTTGGGCTTAGTTGAACGGGCTACTGTATGCAAGCCCTGTGCC
TACCGTAAAGCCTATCTATCTTCTACGAGATTTTTTCTTACCCGCAACACGTAGTACCGTTGAAATTGCATTTGGATACTAATTGGGCCGGAAGCCCACCGCATGGAGGAGCCCATAGCA
CATGGTGATGACACATGTCGCGACGTGACTGGAGGGAGTAGGATGGAAATTTAAGCAAACTCTAATCTTTGAACGATCTTTTCTCTCAAATGTGCATCCAATTTAAAATCCATTTGAACC
ATGGTACTTTTTGAATTAATACTACAAAATGAGATTCAATATGACTATGTTTTGTTGTATTTTTAAAAATCAACATTTTGAATGAACTATCTCAACNNNNNNNNNNNNNNNNNNNNNGGT
GAATGTCAAAAAATGTCGCGCCAAAAAATATTGGTGAATGAAAAAAAAGTTGGTAGGTATAAAAAATTGTTGAGTAATAATGTTGGTTAATGTAAAGAGTTTTGTTACAATGATTTTAAA
GTACCAGTTGTATTTGCATGGACTTTCTTTTCTTATTTTGCTGAAAAAAGAACTAAATAGATTACACAGGTAGATAGTAATTTCCCTCTGTAAATCTTTAACCGGGGGACTGTAAATCTT
TAACCGGGGGACTTTTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGGAGGAGGCGGGAGTAG
CAGCAGCGGGCGCTGTTATTAGTATAATAATTAGTTCTTATTTATCTATGTGTCCGATCCTATGTAATGATCTAGTAATGAGAAAATCGTGGAATCCTTGTTTGATCTATAATTCCTTTC
TGTTGCCATGCAAATTGGCCGGTTTATTTCTATGGTTTTGTTTTGGATGACCTTTTTATTTTAAAGGGCCTTGTACATAACTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNCTACAGCTTCTGATGCTGCGGCAGCAGGTTAATTGGCCTGGCAGTAGCAGGTGTAGCACCCGAACAAGTCATCATGCAACCGTAGAACTGCCCGATGTG
TGGCATGCTGTCCTTTGAGTGATTATGTGTCCCTGCTTTGCGCCTAGGCCCTGCAACTCCCCAGCCACGCTGGTCGATCACGTGGTTCCCACGAAGAGCCGCCCTTTTACCCAGTAGTAC
AACGGCTGCTCGCGCCGGTTCCCAACGCAGCTGCCACCTCTTCCGAGGGGTGCCTGTTTAATGCAGCGTCAGTTCCACCCACGCACATGCCCTTATGCCCTTATGCCCGGCCCCTACCTT
CGGCCGCCATTACACCATTGCGCGTCCCGTCGCCTCCTTCCATCACGCCCCCTTCGATTTCCTTCCATCTTAGCCTCCTCCGTCGCTCCAGCGCACGTTTTCATGGCAGCGAACAAGCAA
CAAACGTCGCTGGAAACGCTCCCTACGGAGCTGCTCACTGTGATCGCCATCCACCTCGTTGCAACCTCGGACCAGCCCATGGAGGACCTCGGCAGTCTACGGGCGACTTGCACGGTCATT
CGCCGCGTGTGCGGCTAGCGTGTCGTCGGACGTCGCGTGGCATTGCTACGGTGCTGGGAGGAGATGCAGTGGAACCAGCCCGGTAGGTACTACTCCCTACTCCGTCTACTGCTTGATGTG
GGGAACTCGGAGGCCTCCTTGCTCACAGGGATCCCAGACTTCTTCGGGGGATACCAGCCGTCCCTCGATCAGCTCTCCCGTGCCGCCGTGGCCGGGCTCAATGTGGTGGCAGATCTGTAC
ACTTTGATGCTGTACAGGAATGTTGGCGGTGCCGCCGCCGATGACATGGCCAAGATGTACATCCGTCGCTTGGAGGGCGAAGAAGGAACGGCGACGAGCAGCAGCCCAAAGATGCTCCAC
AACCACGTCTGTCGGGAGTGCCGTGAGGACGCCATGTACCTCGTGGTGCGAATCCTATGGAACAACGTTGCGCTGCTGCTGGCACCGGGTCGCGGTGAATTCCCCTGCGATGGAGGCGGC
TGCGGTTTCCCTAATGGCTACGGAGAAGATACGTTGTTTTGCAATGAGGACTGCAGGCTACGCCATGAGCTTGTGGCGTTCAAACGGAGACTAGTTGACTAATTCAGTCTTTGTATATCT
ATATGCAGCTGTGAATTATCGTTATCTTTTGCGTTTCTTTTGCTTGTGCATGATGTCGTCCAGGAATGGTTAATGTAATGGTAGTACTAGTGTTTGATCTATGTCATAGCGTCGTGTTTG
ATCTATGTACTAGTGGATGACACTTGCTTACATATTCCATGTTGCATTGTATAACCTCATTTTGCTTACATCGTCCCTTTATCGTTGTCAAGAGTATATGATATGCTAGGTACGAAAGCA
TGTGAAAGCTATCTTCATAATTTATACTGATGTGTCATGTCCACCATCACCATATCGGGGCATGTCATGTTTTGTGTCACCGTGTAATGTTAGGCTCCTNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNGTCTCATTAGGTGAGAGGTTTATATCCACCTCACACTAAAAACACGACTTCAAAGGAAAAATATCTTACAATGCATACTTTCGACTCACAGGAA
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGAATACTTGTAAAGAAGAGTGTGGAAGTTATTTAC
AAATATCTAACTCTAGAATTTTCTCTCATCCTTATATATCCTAGGCCCTGTAGTGTATCGATCCGGGGCAACCGCCCAGGGCCCCTAAAGCCAAGTATACTTGTATATTACATATAGCTT
ATGTATACTAAGTGACCAACTTAAACCAAGCAAACAACTGGTCCAAGTTCATCCAATCACCCATTCGGTAGTTCATCTCCACCGCCAGTCCATCCTTGCACCACCGATGACTAAGGAAAA
AGATTAGCCCCCAACTAATTAGATTATTATTTAGTTTATTATGGTATATTCTTCCATTTTTCCTATTTCTTGTACACAAATTAGATCCAAATCAAAATTTTAATGTTGATTTAAAAAAAA
ACTCTAGTATAGCTGGTTAGATGTAGCAGCATGTATGCTATAGTTTTGACTTGTAAATATAGCACAAACCGCACAAATATCACCAGCTGCTATAAAATAAACTTGATGTTCTTGTGTTTT
ATGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTAGCGAGGCCATCTCTCCCTGCCGCACCTTTGTTTTTTTATCAAGGCCTTATAGGTGTCCTT
TCCTTCTTCGGCGAAGCTGCAAAGGCGCAAAAATCGACTTCTCCAACTAGTCCGCTGCTCCTCTCCGCTACGCCCTGCCCACTCCATGCCGCTGTTCTGGCTGCACTTCGGCCCGCGTAC
GTGCTCGCGGACGTGACCACCAGCCACCTACTCCGCCGCCGGGCTCGTCGGCCCATATGCCTCTCAAACCGGCCGCCGCAGGGCGCCGTGGCCGCGCGCCTGCGCCCCTCCGCGCACTAC
GGCCCTCACCTGCATAGCCCGAAGACGCACGCCCCGCTCTAGGCGGCCGGGTTCAGCACGGCGCCGTGGCCTCGCCGCGCGTGCCTCTGCTACAGTCCCCACTCACACCCGCCGCAGGCA
CAGATCATCATGAGAATACAAGGATGCGGATGCGCGCGGAGGAACTCACCGGACCGGAGGCCTTGCCGAAGANNNNNNNNNNNNNNNNNNNNNNNNTGCCTCGTCGATTTCGTCAGGAGA
AAAAGGAAGACGAGAATGGGGATTGGGGAGGGGGTTTTGCTTTTCGAAACTTGCCCGTGCTTTTTCACCTGTGGGGGATCCAAAGGTTGTACTTGTCCGGCTGCAGGCTGGCAAGGCTCA
GGGTGGGAGCCGAGCTATGGAGAAAGCAGGAAGGTGTATTTTGCCTTTTTGCTTTTCTTCACCACCTGTCCACTATTGCTATTTCGTACGTTAATTTTTGTTCTTGCAGTACGTAGACCG
GCAAGTATTTATTTACATCCCATCCAGATCGCTCTTGACTGCTTTCCTTGTGTGTGTTTGAGCCTTGTGGTGCCTAAATGAATGGATGGAATTCTATTACCACGTACCGTTTCAAAGCTC
ACATGAAATATAGATCTTCTTGGCAAACAAGAGGGATAGAGGAAAAGGAGACCAAACAACACAAATGAAATTCGGTAGTTTGTTTTTTTACTTTTAGTTTTTGTTTTTGTTGAGTGTGGA
GATGATATCATCAGCATGCGATGATGGCATATTGTTTCATTTTTTTTTTCATTTGGTTTGATTTCAACTCCCAACACATGTAAAATTAAAGAGGGGAACCCTTACCTAGCACTCGTCAGT
CGCGATGGCATGGTCAATCCGCCGCAGCAAGATCGTCGCTGCACTAGCCATCCCATTGATCCTGGCTAGGACCACACGCGCANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAGCGCCCCCGACCCCCAATCCTTGTTCTCTATTGCATATAACCTAAGTTTTGTGGTCAAATCAAAATCT
CGACCGTCACTTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNCCTCCCCTTCCCGGCCGGATGTGGCGGCGTGGCGGGTGGCAGCAGGAGGCGAGGCGGCGTGGTGGCGGGCGGCAGCGGGCGAGGCGACGTGCAGGTGGCGAGCGGCANNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCGTAGTATTTGTGTTTAACGCAGGGCTAGGTATACCAACGAAAGCAGTGCTGCTT
TTCCATATCTTACTTTATGCTGCGGTTTTTTCGTGCTCTCCGTACCGAGGAGATGTGGGAGCTGCAGCCTGCAGGCGGCTGCTGCTCTTCAGAACAGACCTGCTTGCAGATCATTCTTTT
GGTGTTGTCCTTTTGCCGGTCTTTTATCTCTCTTCCGGCGATGCGATGTGCATTTGTGTCGCGCAGTGGAGTGCAGGTGCTCACATCGTAAAGGTAAAAAAATAAAGCAATCTACGTGCA
AAATACGTGCAACTAGTTTGTTTAGTAGATCTATCTTCCTTTATTCTGCCCGTGTGCACTGGTGATTAATGACTGAGTGGTAGTACATTGTGAAGTCTCTTTATTAATTCTACTAGTTGT
GTAATTATCGATCACGAGGGGTATTAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCAGTAAAGTTGCAATACCATTTACCAAATACTCTAAATGCAAATAAGAAATG
AAACTGAACAACAATGCCTAATACTTTCACAGTCCACCATCGACACAACCCTTCAGTACACACGGTGCATTTCAGTTCACACAATATAAGAAATGAGATGAAACTACCATCACAGTTCAC
CATCACAATTCACCATCATAGTTCACCCTCGACACAAAAGAGATGACAGACTTAACAGAAACAAAATGCACTTGACAGACCTTAATGACCAGAACCTGCACTTGACAGCCTCTAGTACTG
AACATACATCTTTCGTTCTTGAAAGGAAAGAACAGCTACTACTCAGTTAATTGCTGTGGATTGTAGAATGACTGTTACCACAAAACACAAGAGAGTTTAAGAAACACAATGCGATTAACA
GGGCAGAACAGAATGAACGGGTCAAGGATCGCCGAATGGAAAGCCTCTCATCAGCCAATCATCGCAAAACCTCTCACTGGTCAAATGATGCAGCCATAGCTGCAGCTGGAGCCCCGGCGA
ACCTGATCAAGCTGTTCATCCCATCAACTCTATCTGCAGCCACATTGGCAGTGTCGCCATCGAAGCAATAAGCTGGCGCCTGCCACTTGGAGTCTTCCAGCACTCCTCCCACCTCAAAGC
TCATCACATGCTGCTGCATCCCTGGGGAAAACGAGCGCACAAATCACCAAACTGCTGAATCAACCAAGTACTGCGGAAGTGAAGGAATTGAGACTGCAATCTGAAATTTGCGATTCAGGA
AAGCAGACACTGCAATAAGGCAAGCACAATAACAGGATTTAGGAGCAATCCCCAATCAAGAAACTGGGGAGTTGGAAGGTTCTAGACTGCATCTGTGTACTGGGAAATCACAGAACTGGT
AACTACCATTGAAGAAATTCCAACGGACGGGGCGGCCGGTGTCGATTTCCTCGTAGTACCAGATGAAATCAACCTTGGTCCACAGATGGAAGTCGAAGCCGTCGACGTGCTCGCGGCCGA
GGTACACGGCGCTGTCGGCGAGCCAGTCGAGTGGCAGGATCCCCACGGGGAACTGCATGGTGCGGCAGGACGCGGAGTTGAACTAAAAAACAATCTAACAGCGGGGAGGAGGAAGGGGGG
TAAGTAGTACTCACCCGCACGTACGCCGGCTTCTCGTCCTCGCTGTCGCCGCCCGCGGTGAATTCCCATGCGATGGAGGCGGCTGCAGCTTCCCTAATGGCTACGGAGAAGATACGCTGT
TTTGCAGTGAGGACTGCAGGCTACGCCATGAGCTTGCGGCGTTCAAACGGAGACTAGTTGACTAATTCAGTCTTTATATATCTATATGTAGCTGTGAATTATCGTTATCTTTTGCGTTTC
TTTTGCTTGTGCATGATGTCGTTTAGGAATGGTTAATGTAATGGTAGTACTAGTGTTTGATCTAGCGTCGTGTTTGATCTATGTACTAGTGGATGACACTTGCTTACATATTCCATGTTG
CATTGTATAACCTCATTTTGCTTACATCGTCCCTTGGTTGTTGTCAAGAGTATATGATATGCTAGGTACGAAAGCATGCGAAAGCTATCTTCATAATTTATACTGATGTGTCATGTCCAC
CATCACCATATCGGGGCGTGTCATGTTTTGCGTCACCGTGTAATGTCAGGTCCAGTTTGGTGCTCCGGCTCTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
GTCTCATTAGGTGAGAGGCTTATATCCACCTCACACTAAAAAAACGACTTCAAAGGANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNTGAATACTTGTAAAGAAGAGTGTGGAAGTTATTTACAAATATCTAACTCTAGAATTTTCTCTCATCCTTATCCTAGGTCCTGTAGTGTATCGATTCG
GGGCAACCGCCCAGGACATATAGCTTATGTATACTAAGTGACCAACTTAAACCAAGCAAACAATTGGTCCAAGTTCATCCAATCACCCATTCGGTAGTTCATCTCCACCACCGCCATTCC
ATCCTTGCACCACCTATGACTAAGGAAAAAGATTAGCCCCCAACTAATTAGATTATTATTTAGTTTATTATGGTATATTCTTCCATTTTTCCTATTTCTTGTACACAAATTAGATCCAAA
TCAAAATTTTAATGTTGATTTAAAAAAAACTCTAGTATAGCTGGTTAGATGTAGCAGCATGTATGCTATAGTTTTGACTTGTAAATATAGCACAAACCGCACAATATCACTTAAACTTGA
TGTTTTTGTGTTTTATGGGGCCTCCAACATAAATTTCACCCTGGCCCCCGAAAACTCAAGACCGGCCCTGGTAGCGAGGCCATCTCTCCCTGCCGCACCTTTCTTTTTTATATCAAGGCC
TTATAGGTGTCCTTTCCTTCTTCGTCAAACTTGTACTCAACAACAGGAATGTCTTCAAGCAACTCAACAACAGGAATGTCATCAAGCCGGAGCTGCAAAGGCGCAAAAAACGACTTCTCC
AACGATATTGTTTGCGATAACGGTGACAGTGGCTGCTCTCAACTAGATGCCATTGTGGGTACCTGAAAGAAAACAAATAACTCGCATAAGCAAAAAAAAAGCGGTCGAAAAGGGCTATCA
ATGTAGCTACGGTCTTTTAGTCACTTTATTCCTAATCCTAAAACCTACAATCTTTGATAAAACATACATATGATAAATAGTGCTATTTGAATTAGTATCCGTCCACATTCGATTCCCTCC
ATCCCTAGTGGGGTACTCCAGGCACCAATAACATGCCGCTTCCTTCGACCTGGGCACGCGGACTTTGTACCCTGCTTCTTACTTTACTGTGTCCAATAGTCTAGCTCGGTTATGCAATCA
ACACTTAGTTTACCACTCTATTATGTTCAGTACTATGTGCACTTATTTTTCTTGTTAAAAAAAGGAGCAATGTGTTTTAACATTTTTAGAAGTAGCCACTTCTACTTTTCCTTTTATTTT
ACCATTCTTAAACATTACTTTTGTTGCAATACTAACACTATTGCAATCGGATATAATAAAAGGTCATATGCGTGATTGATACATGGCATGGTCAAGAGCCCAGGATATGATCATACGAGA
AAGTTTGGTTGGTGTAATTTTGTTCTTTGGTGAGGATGAAGTTCGCTGCTGATCGGTTGCGTGCTTTTCTCCTAGATCTATCGCATCGTTTCTCTCTCGACGGAATGTGCATGCAGTTTG
GCTGCAGGGACCACGTGACGTTGCCGCCACACGGCAAGCAACCTAACCCAAAGCTTTTCCTCCTTCCTTGAACCATTTTGCTTTTCGTAACAAACTCCATGCACGAGACGGTGAATGTGT
TCCGGTGTCGGGTTCCCCAATTTTTACATCTTCGAATTTCTGGGGGTGAACGGTCACGTCGATCAGAAAAAGGTCACAAGTCACTATGCTTGCAGCTCGCCTGCACTTACCCGCAGAGAT
GCATCTTGCGGTCTCGAGACCAAATCCCCGCCGTCAGTCACCGCTCGGGTTAGCAAAATTGAAATCAAACCGTGGTTCTAACATCGGTGAACAGGAGGCGGCCTCCGTTGTTGGCATGGC
CGTTGGCCAGCAAGCAGCTCCGACCATACCCGTTTTGATAAGGAAAAAGTCATTTTGACGTCCCTCATCCGAAGTCTGGCTTTCGTCCCTCATCCACAAAACCGGATATCTGGCATCCCT
CATCTATCTAATTCATTTGTTTTTGTCCCTAGCTGGTTTTGACGATGGTTTTGCATACGTGGTAGTGGGTCCCACATGTCAGGGTAGGTCCCACATGCCGGTTGGCTTTCTTTTCCCCCT
CTCTCTTCTTCCTCCTTCCCTCATCTTCATTCTTCCTCTCGCCGAGTACGACGGCGGCGGCGCCCTCGGCGTGGACAGCATCGATGGCCTCAACACCGACGAGCCACGGGAGGTCCCCAG
GATCGCCCCACTCGTGCCGGCTCTGCCCACGGGCGGCGCCGTGCTCGCCCTGCAGGCCACGCTCCTCGTCCTCCGCCAAGCGCCCCCTCGCCGCGGCCAAGGTCTCCTCCTCCTCCGCCA
ACCCTAGGTCCAGCTCATAGACGCGGAACCTCGGTGAGCCAGCCACGGATAGCACGCTCATTGTAATACTCCTAAAATTTAGAAATATTAAATTGAGTGGAGTTTTGAAAAATTTAAACT
TTTTGCTTGAATTGTGTGCCCATTTAAAAATTGGAAGTCAAATTCTATTCTCATCTAAAGCCTAATAAATAAATCCCAAATTCCATTTCAAAACTTGCGCTGGTGTGATTTGGATCTTTT
CATATTTTATTTGGATCTCAAGTTTGAGTGTGTTTGAATTTTGAATCTAATTTGAAATTCAAACTAAATATAAATCTAAACCTAAATCTAAATAAAAACAAAACCTAACCTAACACCTAA
CCTACCCAGGCCGGCCCGAAGCCAAACTGGCCTGGCCCGTCTCACCCCCTCTCCCGCTTGCAACCCAGCAGGCCGGCCCGCCAAGCTAGCTGCCAGCCCGTTAGGCCGCCTCCGCCTCTC
CCTTTCTTTCCCTCGCATCAGCTTTTTCCCCTACCTCGCGCCGACGCCCCTCTCCCACCCTAGCCTACCGCCTGCGCCTGCGCCGCTGCAGCCTCGCTGGTACCCAATTCCGCGCACCTC
CCTCACTCCGTGACAACGCGAGGAGAGTCCCGCTCCCACGTGCGCACCCCGCTGGCCCTAGCCGCGTGGCCCGTGACCCTTCTGAAACCTTCCACGACGGGGAAATCCCCACCGTGCCCT
TGTAGACCACCGGCCTGCACCCCGCAACCCTAGCACCGGGCCGTCAAATGGCCGCCACGCCACCCTTGGGCGCGCCCACCAAGGATGGACAGTCGTGCGAGCTCGAGTGCCACACCCGCA
ACCCTAGCCTCGACCGGGGCTATAAATACCCCGGCCGGCCACCCTCTCCAACCCACCGTCCAAGCCCAGGGATTCTCCCCTTGCTAGCCGACGTCAGCCCAAGAGTGANNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCACGTCGGGAGGAGCCGAAGTAGCTGCCGGCCCCGTCGCTGACGCACCGCAAGAGAAGAGCTGGAGCCACCGC
ACCACCACCACCGCCGCCAATATACTCGCATCCATGCCGGCTAGCGATTCCACCGGTTAGATAACCGATACACATGAGGTTTCTGCAATAATACTCTATGCTGTTGTAGCCTGACGAACT
AGATTGAGGATGACACAACCTTGCATAGTTGACTTGCTTGAAGTTAAGCANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGATGCCGTCGCTCCTCCG
TTTCATGCGGGCACATGATCCATCCTCCAGCTCAATGCAAGGTGGCTCCAACCATGGCAAGCCACACATGGTGGATGGTGCTGCGCGATGTGGCGTAGGGGAGGCAAGGGCGGCCAGCTC
AGGGGTGGGCAGAGGCTGACACGGTGGAGGGCGGCGACCGGTGCCAAACACGAGGTAGGTCCAACCCACCCAAAAAACAGAGTTGGTGCCAACCCATGGACTTGATCCCCAAACACATTC
TAATTACTTCCCAGCTCTGTTTATGCATGCAACTTTAAAATGCACGAGCATGCATGTAACGCCCGGCAGGGGACTCGATGTAGCATAGTTGACTTGCTTCAAGTTAACGATATGCTAGTT
CTACTTGTGCACGCTGGGGTAATAACATGGATGAACATGTAACGGGACCATAAGAGAGCCACTTAATGATTTACCGAGACCACGGCAGGTTTGATTATAGTTTAGCGAGACCTCAAGAAA
ATCACTTTATACTTTATTAGGACTAATGTGAAGGAATCGCGATCATATATATAACTTTATCTGAAACCTGAAGAAGAAGATATTGTTAGAAAGGAGGTTTTGTAAGACTCGTAGTGATTA
TATATTCCAAGTTGCAACAGGTCTTTCTTTTCTGTCAGATTAAGCTTATCAATAAGATCTATAATTTAGAACCAACAACTACCAAAATAACAAAAATACTGGTACAACACCGATCGATCG
TGACTTGTCCGAAAAAAAAATGCAGGAAGATGTGCGTATCATGAAGGATATGGGGATGGATGCCTACAGGTTTTCCATCTCGTGGAGTCGAATTCTTCCAAGTGAGAATGATGAATTGTT
CGGACTTGCTGCAACGCCATGTTTTGCACATAACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNAGATCTATGTTACATATATATATATATATAGGTTGTTCACGCTTGCTTGTGCTTGGTTGCTCCCTAGCTGGAGAGACGAGACGACGACCCAACTGCCGACCAGACCCTGGTTGTTG
CCATCGTCCAACCCTGATGCTTATCTCCTCACAGGAGCTCGGCGAGTTGCGTTATCTTTTGTTGGCCACCAGTTTCTGGTTCTTCTGGCCTTTGCTTGTCCATGTCATTCTCACTTTGCT
CCTGCACCTGCCAAATGCCAATGCACATGTCTCATACCTGCTTCAAGTGATCCACAAGTCGCTGGACATGAAAACATGGGTGCAAATAGTCTTTCAAAAAAAAACATGGGTGCAAATAAT
CTTTCAAAAAAAAATATGGGTGCAAAGAAAGCCACAGGTAGACCGTCATGTCTATCTGTGCAGCTGCTTATGTGGCTCGCATGCACAATCATGAGCTTGCAGATGTGCGGCTCCATGAAA
ATATTATCAACATGCCCCTAGGACCAGAATTAATTGAACAGATATACATCGATGCTGTCCAAGTATGAGACAGCGACACCAGGTAATTTGAGATATATATACTGATAGGCAAGAATTTGA
GAAAAAAGAAGCGAAAACAGCACATCAACTAGATTACAGGCTTACAGCTAGATTTACAGCACATCAATTTGCTTTCTTAAACTGGATTAGGCACGTGTTACAGGCTTACAGCTAGATTTG
CACTGTCATAAGTAGGATAACAGGAAAAAAAATAGCAAATGATGCAGTATATCAACTACATCCCCTAGGCTAGTACATTCCAAAGGCACTAGCATTCTTGCAATATGAGCAGATACATCA
AAAATAACTTGTTTGCTACTCTGCTCCATGTTGGTCAGTTAAGGTCTGGGGCGCAACATTGAAAACAAACAATGCACTTTCAGCAAGAACTGAAGTACATTAATTTAGCTACGAAGTCAG
TAAAAAAAATCTGAATGTTGACAGGTTAGTTGATGAGTGATCTATCAAACTTAAACTTTATATTCTAAAATGGACTGAATGGAACCTCAACTAGAATTTTTCAGACAACAATATCTTTTT
CTTTACTTTTCCTTTTGCACTTACTTTTTAGCTTTGCCAGAAATTTCACAAATTTACAACAATAAAGAGCATGCAGCTCTGAGGAAAGGATGAGAGCTTACAGTTGCTAGGATCCAGGAA
GCCAATGGCCACAAGAGCTCCAGGTCCCACATGAGCCAAGAACTTCCTCCATTTTGGCTGTTACCACCAACAAAAAATAGCTGGGGCAGAAACAAAAAAGGGGACTGAATTTTAACTGAA
AACATGGAAATACTTCAAAGAAATAAGGTTTTCTGCTAACATGGTAATACAAAAGTTAAAGCATTTAAAAGAGAAACCTCTACGCAACAGCATCCAAGAATTCNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNATCTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNTTTGCACATCATCTAACTTGAACGTTTGAACCTAATTAATGACAGATGGAAGTCTGAGCGGTGGAACAAAGTCAATAAATAGAGAAGGCATCAGATACTACAGTAATTTGAT
TGATGAGCTTCTGTTGAAAGGTGTCCCTCACGCAAGAACCCTTGCAGCTCTTTTCTTTACTCCACCAGATGATTTTTTTTTCCTCTCTTTGTGAAGCTATGAGATGAAATGTATATATTG
TCTACAGGGGTTCAACCATTTGTGACCCTTTTTCACTGGGATTCGCCACAGGCATTAGAAGATAAATACGGAGGATTCCTTAGTCCTAATATCATGTAAGCCATGTTTTCTTACTCCTTT
GCAGCTCAAACATACCATTAGCTCAGCATGCATATGCAGATATGCTAAACTGGGAAGCGACGACCAGATTAGGAAGCTCTTACTGATCAATACGAGCTGATAATTTAGTTGAACTACTAG
AAAGCTTCCAGTTATTAGAAAAATTGACAACATATCCTTGAGAAAAAGAACCAAAAAAGGAGAGGAAAAACTTGCCCATTGACACTGCCATTGCAAATTGATACCACTTCCTTCCTCCAT
GCTTAATTGTAGTTTATGCACGCACTGAGGTCACCTACTAAAATAGAACCTTTTCTGTTGCAGCAACGACTATAAGAACTACGCTGAAGTCTGCTTCAACGAGTTTGGTGACCGAGTGAA
ACACTGGATTACGTTCAACGAACCCTTGGCCTTTTGCGTAGCAGGGTACGCATTGGGTACGTTTGCGCCAGGACCGTGCTCGCCATGGGAGCAGGGCGAGTGTTGCGCTGGGGATTCAGG
AAGGGAGCCTTGTACCCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGC
CCAGGCAGGCGTCCAGTTCCTGGTGCAGCAGCTCAAGGCAGCAGGCGCCACCAGTGGCCCATCCGACCCCGCTCCAGCGCATCAGGTGAGCAGGCAGCAACAGCAAAGGTTTCTGCTTGC
AGGTTTATGCATGTCACTTTCAGTGAACAGTGATCTAATCATTGGCTTCATAATTTATTTCTTGTCTGCTTGCTTTAGCTCTTTTCACAATCGGTATGAAGTAATTAGTTAGGGAACACC
CGCTAAACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTAGTACTTTCACCTGCTAAGNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTACGATTGCATTTAAGGATGACCACAAGTG
GAAGAAGCGTGATAAGCTGAACAAGGATGATGAAGCGAAGGTATTGATGCGTTTAATGGAAAAGATGCCTCAAGAAGATGATCTTCGACACAAGCTTCACAAGATGAGTAAAGATAAACT
CTCCCAAGGTATAATTGGTTTGTTCACTCACCTTTGTGCTCATGGCAGGACGATTATGGAGCTTAAGAAGAATTTGGACATGTCTAGACTTGATAATATATTAATATGAATACTTCAACT
TCTTGCAAGTCTAACTTACCTTTGCTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAGAGATGTCTTTCTTGGTGACAAGCAACTTGAATATCATAGAAACTTA
TTTGATGAGCTCTCAGTTGATTATGCTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGAAGGTTCCCA
TTCACCAACCCCCCGGGTCGCCCGTCCCGGTCCTGCATGCCACCATCTAATACTCGCCCATGCGGAAACTGTCCGTTTGTACAAAGAAAAATATCAGGTAAGTGATGAATTCTCATGCAG
ATGCAACTTATGAACAACTGATGGAATGATGATTTGTGGTCGATTGATATTTCAATGTTTGTGAACGGAAATTTAATGGATAGGTTGACATGGTGCAGAAGCTAGCTATTTCTTCTAGTC
TATGGATATATTCAGAAGTTGTACAGTTTAATAGGAGAACAGAGGTTCTAAAGCTTACAACACCATGATGTGTTTTGGGCCTTAATAAATTGAAAACGTGATGCATCCTATTTCCAAATA
CAAATTCATTTAAGCTTGTTCTTAGTCATTTTTATTTATGACTATTTCATATAGATTGACAATATAAGAATGATCTAATCAAATTCATCATGAAAAACTTACATTACATATAACATATTT
ATATTGATATTAGTCCAAGTGTCATACTGGATACCATCCTTCCTAATAGACGTATATAACATCAGAGGGAGTGATTGGTTATTCGATAAATAAGCGTGTATCCAGAATGTATTGCTTAGT
TTGTTAGCCAAATAATGACATTCCGATCGTGGCAAACAGGGTTAAGCAGAGGGGAAAGATTGAATGTCATTATTTGGCGAACGACCATTAGTCTGACATATTCAATGTCACATTGCAGGC
TGTGCAAAAGGGAAAGATTGGAATAACTTTGGTCACAAATTGGTTTCTTCCTTTCTCCCGATCTAAATCTGATGGTCATGCAGCCAGACATGCCTTAGACTTCATGTTTGGATGGTAAAT
TCCATATTGCCCTAAAAAAGAGTCATTGTCAAAGTTTGTAGTAGGATCAAAATTTTAATAGGAATGTGCTTTAGGTTTATAGACCCCCTCATTTCACTATCCACTAAGCATGAGAAGATT
GGTAAGAAAATGCTTGCCGCGGTTCACAAAGGAACAATCTGAGTTGGTCAAGGGTGCATTCGACTTCATCGGACTCAACTACTAAACTGCAAGCTACGTTGATAGCCTTCCTCCATCAAA
TGGCCTCAACCTCAGCTATACCACTGATTCTCGGGCTAATCGTACCAGTGAGTCACCTCAATGATCCTTGTGTCACCTCAATGAATCCAAGGATCATTAGTTCCTATTATTGATCTCATA
TTAAAGAAGAGAGTATTTGAATCCACATGACATTTTATTGTTGCAGAATTCTAGAACAAAATAGAGAATCTTTTTTAACAAAACTAAGGATGTCATCTATATTAGATTGAATCATCTGCT
TGAAATGTTTCTTTAGCAACATTTGAGATTGTTTTGGAAGCACAAGCATTTCCCTCCTTTTCTGTTGTCGATATACAAGTACTAACTTCCTTCTATTTATTGTTAGGTGTGCGAAATAGT
GTCCCTATAGGTCCTCAGGTAAACATACAAAGCAAATTATTATAATAGAAATAACAGTGATCTCCCCTCTCCTGAGCACAATTTCATAATGCCCTTCCGAAAGCATGGTAGCAGCTCCCA
GTAATAAAGTTATGAACAATTTATCAACAAAAAAAAATGTTACAGCATTGGTTCAACATGTGCCTTCCTGTCCATAAATATTCAATAAAAAATAAAACCTTCACAGCTTGATTTCCTTTT
TCAATTATGTGCTTGATCTGTTGATATATTTTTATTTTCAAACCAATATTGTGATTTCTCATGACATTTGGCAGTGCTACTGTGTGGTAAGGGATAGTAAGCACTAGGAATTTTGCTCTG
CTCTGCTCTCCCTCTTATGTGTGACGATTCATTTCCATAAATGGGGTTTATGCAGGCTGGTACTTCTTGGATCTACATGTACCCTCAAGGCTTCCGTAAGCTGCTGCTTTACGTTAAGGA
AAACCACGGCAATCCTCCGATCTATATCACTGAAAACGGTAACTTCTGTTGATACATTTGCTTCTTTAATTTGCTATCAGTAGATTGGGTTATTTCTTCGCTCTTCAAGGAAGAATGACA
GACAGAGAAGGATAGCTGAAAATATTTTACTCTGTATTTCAGGAGTTGATGAAGTCAACAACCAGAGTCTACCTCTCCAGGAAGCCCTGAATGATGACACCAGGATAGAGTACCACCACA
AGCACCTCCTTGCCCTGGAAAGCGCTATAAGGTCAGAGCTCCAGTAGTCCATGTACAGTTCATTCATGCAACGCAAAGAAACGCCGGAAAACTTCAACTTGCTGCTAGCTGATATGATGG
TGCATCATTGCATCTGACTAGTGAGTCACTGCATGCAGGGACGGGGCAAACGTGAAAGGATACTTCGCGTGGTCGCTGCAGGACAACTTCGAGTGGGCGAGCGGCCACACGGTCCGGTTC
GGGATATACTTCGTCAACTACACAGATGGCCTCAAGAAGTACCCCAAGAGCTCTGCACACTGGTTCAAGGAGTTCCTCAAGAAATAGGCATGGTCGCATGGAAGACAATGCTAAACAATA
AGCATGCATTAGTGTCGACTGGTAACAAGAAAATTGAATAAAGTGTGCTCTTGTTGCAGCGTAAAAGAAAATTATTCTCCATGCACAATAAATCAATAATAAAGAATAAGTTCCCTGTTT
GAAGTTGATTCAGATTTCAGAGAGACACCAGACAGGTCTGAATGTTTAAATCCTCTGTTGAGCAGCTGGCTGTCTTGTAGGCTTGTAGCCATGGGCCGGCACATACGACTGCATGTCAAG
GTCCCAGTTCCTGAATTACACAAGCCCACAAGCGGCACCGTACAAGGTTTGAGGGGAGAATGATGCCTGCGCGGGACGCCGCTGCCGCCGTGCCGAGCGCGAGCAGCCGCGACCGCTGTG
GAGCCGAGCCGAGCCTGTCTTCACCTCCTCACCACGTTCAATTGCTTTTCTTTTTTTTTCTTTTGAGCAACGCGTTACCTCAGGTGGTCGGCAGATTGTTCAGGCAGCTCGTGCGCGGCC
AATTTGCGAAAACGGTGTTGGATTTGTATCTAATTAGGGCCCGTTTGAAAGGGTTTTTGCCAGCCGGCTCCAGATTCACCTGCTTTTCGCAAGCCAATGCACACTATTTCGTAAATCAAG
GCAAAGATGAACCGGAAGCTGAATGAAACCAGATTTTTTTTTCACTGGAGAAGCCATTTAGGCCCTGCTCCTTGCTTACGAGGAGTAGTTTGGGATGAGTGACCCCCAATTTATTCGAGT
CGATGGTCTTATGATATGCCACGCATAAGTAGATACAAAGGATCAATGCGATGTAATGTAAAACAAAAATCAAAGAAAAGGTAATTGGGTCATGTGTGCTGGCCCATCTCGCCCACTACA
AGCATGCCTCTCTTTTTTCATTTTAAAGAACAATGTTGAAATGCACCACAGTTGACGCATTTTTATGATGAATGATATATTGACACGGTGTTGAAAAATTAATATGGGAGCTTTGGGATT
GCACGAGCATGTCTACGAAGGTGGTGAAGGTGTAGGGAGAGGATTTTGAAAACATGTCTATGACTGTCTTTATGATATGTCAATCAATGGAGTCAACATGGTGATCAACGGGTATGCATT
AAGTGACGAGCATATCTATTTCCATGTCAAATANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTACATAGCTCAAACTATGGTTTCAACTAAACACATCTCAAACACACANNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTGTGTGAGAGAGA
GAAGGGAGTATGTCTCTTAAAATAACCTATCTAACCGATCTTATCTCATCGAGATGCGCTTTAGCAGCCATTTTTTTCGCACTAAAAGCAGTTAGCAGCCGTAGCGCTGCAACCCGAGCA
ATTTTTTCTGCATATGTCCACTATCTGACTGTTTTTTTTTAACAAACACACTATCTGACAGCTGCCTACTCGAGATATGCACGTGCATGTCCCTATCGGGGTGGTTATCGCTCATGCATG
GATCAGAATCTTGTCGCGATTTGGCCGTGCACGAGCTAGCCGACGTAGTATCTTGCCAGAGTTGCACATGTACTGTACCTGCAGTCCTGCAACCCTGCTGTCATGGTGGGGAAGAGAAAC
AGAAAATTGCGTTACGTTAGCTAGCCTTTCCGCAAGCCTACATATAACGGGTGCCAACGGAAGCTTTTCCGCGAGCTCACACTCTCCTGCCGCCACACCCATCGAAGGTGGCTGCAACAA
TGCTTCTTGGTCGTCTTCTACCTCCGTTTCTCCTCCTGGCAGTCGCCTCCGGTGCCTACTACGATGGCGCCGGCCAGCCGCCGGTGAACCGGAGAAGCTTCCCTGAGGGGTTCATCTTCG
GGACGGCCTCGTCGGCCTATCAGGCAAGAACTTCTTTGTCGTCCTTACATGGCGTTCTTGCGCATTAGTTTCTCTTTTCTAACTCATAATCGTAGGACATTTACACATTTCCCACTAATC
TTCTACGGATCGTGGCTTTACTTTTGCGTTGTTTTTGTTTTTGCCATGGTCGTCTGACGAGTTGCTCTGATGTCCACACGCAGTACGAAGGGGGTGCAGCGGAGGGGGGCAGAGGGCCAA
GCATCTGGGACACCTTCACTCATCAGCACGCAGGCATGTTTCATTTCTATAGGAAGCAGGGACTTTAGGAGTGTCTATAAACAAAACATGGAGGCTAAATTGAAACCTAATGCCGTCGCA
GACATGGCTTAGAAATCTTGCCTCAGTTTAGTCAGTTAGCACCAATGGAAAGGGAAATCTCCATGTGTGCTAAAACCGTCAAGAAAATGTAGGAAACCATCAGAAATAATATTTCTGTCG
GCCAAACGATGGGCCAATACCATCAGAGATAGCTTGATAGAGAAATATGAATTGCACGTCGGTTTCCCAGCAAAAATAATTTTCCTGAAGGTAATTTTCTGGTGGCTGCCTGATAGAAAA
TTTTAGTGTGATCAGTTTTTGAAAACCATTGGGTACAGACAGGTTAGAGCTTTGTTTGTCGGTTCACCCAAGGAAATATATCATTTCCCTGATGGTGACTAGACGGCAGAGAAAACTGGG
TACCGTCAAAGAAAATACCTGACACGAAAGAAAACTCCCAGATCTGACCCTGCTTTCATGACGAAAAACGACGTCATATTATTGATAGGTACTCCAACATTCAGTCATGGATTTAGTCAA
GTGGTCACTGCCTGCTCATCTTTATTTTTTTCCCATAGTTTAGTTTATTGAACATGACTAATGAAACAATAGTCCAACGGAGCAAATTTCTTAAATTTTAAGTGGCAAGAAACAATACAC
AAAGACTCATCTTTGAAATTTTAACAAATTTTTGGTTTGGCAGATAGAATCGCTAACAGAAGCAATGGGGATGTGGCTGTGAATTCCTACCATCTCTACAAGGTCAGAATTCAGTTTGAT
GTTTTTTGAAAAAGAAAACAGATGCCGCCTTTTGAATTTGTTGATTCTTTGAGAAACTCAATGAATTATACACTCTAATTCGTGTTAGGGACTTTATTTTCTTTCAGATGCTTACCAAAA
ATATTATAATTACATAACTCATCCAAAGGGTCTTGCTGGGAAAAAAAACTGCAGGAAGATGTGCGTCTCATGAAGGATATGGGAATGGATGCGTACAGGTTCTCCATCTCATGGACAAGA
ATTCTTCCAAGTCAGTTTGACCTATTTGTTCAGATGAGCTACTGCATCGTCTTTCATATCTTCCGATGTCCAAGTAGATAAAGTCAAACTTAAAGGTCTGAATCTCTTGACAGATGGAAG
TCTGAGCGGTGGAGTCAACAGAGAAGGCGTCAGATACTACAACAATTTGATTGATGAGCTTCTGTTGAAAGGTATACACTAGGACCATAACACTGTTTCTTAACCCACCAGATGGATTTC
TAGCCTCATGAAGCTTTTAAAAAAAACATGCATGTGTACACATATCTGCAGGGGTACAACCATTTGTGACCCTTTTTCACTGGGACTCGCCTCAGGCATTAGAAGATAAATATGGAGGAT
TTCTTAGTCCCAATATCATGTGAGTCACAATTATTACTCAGTCCTTTTTCAGACAACAATTTCTTAATCCCAATGTCATGTTAAGTCACAGTTCCAAGAGACGAGATGATTGAGAAACAC
TAATTGCTCCTTAGTAAAGCATTAACAAACACTAGTTGAGTACAATAAGATTGTTTCATTTACATTAAAAAAAAGATTGATTCATTGTATCTGAACTGCCTTGTTTTTGTATAACATAAT
AATATGAATGCAAGCATTGGACTATAACAACTTGCTTCAATAATTATTAACATCATGAACTGTACCAATTAACATGGCCTCGTTCAGCAAGCATTGCACGAATGAACTCTTATCCATATG
AACACTGGCTTCCCAAATTCGATGTAGCACTTTGATCATGTATGCTTTGATGTTGTTTGCACATAGAAGTCACCCACTAAACAAAACTGTAACTATTGCAGCAATGACTATAAGGACTAT
GCTGAAGTCTGCTTCAGAGAGTTTGGGGACCGAGTGAAGCATTGGATCACTTTCAATGAGCCGTGGACCTTCTGCTCTGTGGGCTATGCATCCGGCACATTTCCACCAGCCCGGTGCTCA
TCATGGGAGGAGGGCAAGTGCAGCGTTGGGGATTCAGGAAGGGAACCTTACACTGCATGTCATTATCAGCTCCTTGCCCATGCAGAAGCAGCTCGTTTGTATAAAGAAAAATACCAGGTC
AGAAATAAATGCACTCTCAACACAGTTGCAATTGTTGAATGAATAATACATCAATTTGGAATATCCAAATTTGAGTTTGTTCTTTAATTTATCTTCTGAGTTTAGTTTCGATTGGGTCTA
GTGTAAAAGGGGGGAAAGTTGAGTCATCTAATTTACTAACTGATTTTTTCTCTTATTTCTTTTCGAAGACCTCCAGCAGACAAGGGTATTTTGGATTATAAATTTTTAGAGTATGTCAAA
TCTATGTCCATAGTTAGGTCGTGACTTCATCAGAACCAACTTGGGTTTTATAGAAAAGTGGTAGATGGACTATAATAACAGGAATTAGCTATTTCAGTTTTTTTCAGTGGCCTAGTTAAT
TATTTCAGGTTAGCCAAAGTCATCTTCTAGTGTATGGGACTATGGATATATTCGGAACTTGCACATCAGAAACTTGAATCCTACAAGATGTATGTATTACTATAGTTAGTTGTGTCTGTA
TGGAAACTTCTTCTATGCTCTCAACAATAAATCCTGCCTCAGCTGTACGTGATGCAAACATTCAGTAAGAATATATGGAATATGTTATTTAAAGGAGCAAGTTATTTGAGAATATGCTCT
GTTAGCCAAATGAATTCCTTTTGTAGCCAAACCTTGGTATTTCCGTTCGTCGTAATGGAAATGGGGTAAAGTCTCGTATCGGAAAAAAAAATCCTTTTTTGACCACGATTTTGATCTCTC
ACAATTTTATGACATATTGAATGCAGGGTGTACAGAAGGGTAAGATTGGAATAACTTTAGTCTCACATTGGTTTACTCCCTTCTCCCGTTCCAAATCCGATGTTGCAGCAGCGAGACGTC
AAGTAGATTTCATGCTTGGATGGTATATTCTAGGTGACCCTTGCAAAATTTCATCAAAACAAATAAAAACTTATAACAAGATGCATATTTTACTGGGAATACTCTTGAAGGTCCATGGAC
CCCCTCATTAGAGGAGACTACCCACTAAACATGAGAAGGTTGGTGGGAGATCGCCTTCCGCGATTCACAAAAGAACAATCTGAGTTGGTCAAGGGTGCATTCGATTTCATCGGGCTCAAC
TACTACACGGGATACTACACTAAGGACGTTCCTCCATCCCTGAACAAGAGCTATAACACAGACTCTCAAGCTAATACTACTGGTGAGTCAACAAAGTGTTGACAACCATCTGTTCTTGTT
AATCTAATGTTAATGAAGAGCCTTTGAATTCGATCAAGAGTATTGTCTCTACAGCCTCTGCTGCACTAAATTATCTTGAGCAAGGTTGAGATTCGGTTTGGAACTGCATGCATTATTCCT
TGTTCAGTTTCTTCTGATACATACTGACATCATCTTATATTAGGTGTTCGGAATGGTTTCCTTATCGGTCGTCAGGTAACTAGTCATGTCTCCAAACAACCACTTCAATTCTCCAGCAGT
AACTTCCCTTCCCATTTTATGTGTGATGATTCATTTCAAGAAGTGGAATACATGTATGCAATTGTAGGCTGCTTCACCTTCGCTCTACATCTACCCTCAAGGCTTCCGTGAGCTACTGCT
CTATGTGAAGGAAACCTATGGAAATCCTACCATCTACATCACTGAAAATGGTAATACTGTCGTTTAGCACCATCTCCTTTTGCATTCAACTCACCACTGTAGTACAACACAGAAAGAAGA
ACTAAAAACAGAAATTGTCTGAAGATATCCCTCCCTCACCCTGTCTTTAGGTGTTGATGAAGCCACCAACAACAGCCTGCCACTACATGAAGCCCTGAAGGATGACATCAGGATAGAGTA
CTACCACAAGCACCTTCTTGCGCTGTTAAGTGCTATAAGGTCAGAGCAAATTAGTCATGAGCATACTCTAGTATCACTGAATATGAAGATGCCCGTGACTCGACCGTCTCGCATCTGACT
TTTTTTTTTTTTGCAGAGATGGAGCAAACGTGAAAGGGTACTTTGCATGGTCGTTGCTCGATAACTTCGAGTGGAGGGATGCCTTCACGGTCCGATTTGGGATAAACTTCGTGGACTACA
ATGATGGATTGAAGCGATACCCCAAGAATTCCGCGCATTGGTTCAGAAAATTCCTGCAGAAATAAGCGTCCCGTTATGGGAAATAATGGTAGCATTTCATACTTAGGCGCTGCCGCATGT
GTTCTGTGCCGTTTCAAGCAGTGCGCTTGTTCTTTTCTGGAAATAAAGTGCGGGAGTTGAGCTCAGTTCAGTTCAGTGAGCAAACTTTGCTGGAATAATAAGAGCTAAGGGGCCCGTTTG
TTACTTGTTATGCATGTTCTGCCTGCAATTTCCAATTGTGCATAATTTCTTAGATGTTCAATAAAGAAGATTTTTTACAATACAGTAGCAAAAGCCACATTTTCATTCATTTCATAATAT
TTTCTCTTACCATTAATTTTTAGATTCAAAATTAGATCAACACCATGACATGCTCGTGCATGGTTCACAGGAAACAATTGTTCCTATCACAATATAAAAATGATTTGATCGATTCAGCTG
CCACTAAACAAAAGGGACATGACAAGAAGCTGAAATTAAATTACAGTACTAACCTGAACAATCACCTGTGGCTTCAAGCACACCTCTCCACCTGTGGTAGAAAAATATCCCTATATTGCT
CAAACTAAAAAACAACAAAGAGTTAACATACTGGTCACCAAACTAAATAATAGAGCTTCAATGATCTAAATAGCTGTTTGCGATCGTAGAGGTCGAAACTATTTCCTTTATTAAAAAAAA
GCTAACACCACCTCTCTTTTTTTCAGCTAAGCTAACCATGATCTACTACACATGTTTTTAACTTCTTTCGCTCAGAGACTATTTCCTGAAAAAAATCTCTCAGATGATGTGATGCCTTGC
ACATGCATTTCTCAAAAGAGTTTAGATTGCAAGCCCAATAAATACTTGGTAGATAGCCTCTTGCACTCTATGGACTACTAAACCTAGAGGTCCTCGTATCATTGTTTATATCTTGCTCGG
TCCGTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNATTAAAGGAGATGCCGTCCTGCGTTTCTCGAATTTTTATATGCCCATGCATCTAGCATATATACGATGCCGTGTCCATCGTCCATGTCCCTGTCATTGT
AACTGTGCCCCATGGGCGTCTCCCACACACCATCGTCTAGGACTAGGATGTCAGCCGACCGATCCGAAACGTGCGTCTGATGCGGTGTAAAGATGAGCGCGCGTCGGTCATGCCGGGCGC
GCGGCAAGCAAAAGTTCCTTCACTATCTTGCCCAGGACGACGTGTGTCTTAATGTTTTTCGGTTGGTTTGTGCAAAAATGGAGCTTTCGGACAGCTCTTGAGTTATTACGGGTTGAGAGC
GAAATAGTAGGGACGGACAGGGCAGGCCGTGGTGGTGTTGTATGTAATTGTATACTCCATCCACCGTTCAAGGAAATGTCCTTGTAGCACTGCTGTCTACATCCACAAGGTGCGGTGTTG
ATGACGAAGATGCATGATGAGAGCGATGACGATGAATGAAGGCACCTGAGTGTTGAGGAAGATGAGCCGTGACAAATATTGATTATTGAAAGCAATCGCTCTGAGTGCACAAACTTTTCC
CATCCTCTCCCCCGTGGAGGGGGATACTTTTCGTAGATCACGGCAAATAAGATATCTGTGTTCTGTGTTCGTGTTTCATGAATTTATTTAAGGAATTAGCTGCATTGTACTTTTAGGATA
GGTGACGTGCCGCAACTTGCAAGTGGTGATTTCACCAATCTTAAATCCGTCCGTCCACATCTCTCGGAGGTGCTCATAGAGGGTACAGTTGCATACATGTATTCGTAGGGAGTGTTTGTG
CGTGTACGTGAGTATCTGCGCGTCTGCAACTGTGTGATTGAAAAAAAAAACATTCATACGCCTGAGAAATATAGAGGGGAGGCTGCATTGGTGGATGGGAGGAGCCAGGCGCAAACCAAC
TGAAACTGGATTGGCAAATTCTGCCAACTGTAGCAAGCGTCGTCGGCAAAACATAGGACGAAGGTCGCCATCACAGGCAGCAGCAGCAGCAGCTAGCACAGACCGAGGGCCGACGATTAA
TTCAGAACCTTCATTGCGCCAGCCGCGTCCTGACAGCGCAAGAAGAGTGAAAAACATGAGGTGATGCTTCCGTCCCTTTGCTCCATTCACGCTGACATCTTTATCTGAGTGATCCAGCGA
AATTTCCGGGACCAGCAGGGAGCGGCTCACTGGCTCGGTCGGATAAAATAGGATGCCGTCCGGGGTCCCTGTCCCAGTCCCAGTCCCTGTCCCCGCAGCCAAGTCTTCAACCTTCCGATC
TTCATGGACATTTTACTATATATGGAGGTGCCAAAGGAGATCAACCTAGCCAATCACTTATAACAACGAAGCTTAGCTCTCTCGCGGCACTGCGACAGCGCACCAAACGGCCGCGAGCGT
AGCTGCCGCCATGTCCGGTGCTCGTCTGCTGCTTGCAGTTGTCCTTGTAGCAGTCGCTTCCGGCGCCTACGCTGGCTATGATACAGCCGGCACGCCGCCGATCAGCAGGAGAAGCTTCCC
TAAGGGATTCGTCTTCGGGACATCCTCATCGGCCTATCAGGTAGACAGAGAAGTTCACTGGTATTCGCCGTAATGGCCGGCAATGGTTTTCTTCTTTTGTCAGTAAATTTATGGGGTCAT
CTGAGTCCTGTCCCTGATCATCTGCGCCGTATTATGCCGGAGTTTACACGTTTCTAATTTCTCAGGAGTCAGGACGATGAACATTTCGCATAGATGACAAGTAGTAAAATCATAACCTGA
TAGAAGGATACGAGCTCGTTGTTGGAGTCCAAAATAAGTTCCTTCAGAACCTTAACATGTATGCAATTTGTGTGCCGGAAAAATGCATGCACCGACAGATGGTATGATGGGAGAAAATAA
AGTTGAAATTTGCAGCTGTTACCAGGCAGATATTAGACCATATACCTGATCTGCCAATTAATTACTTCTCAATAATTATTGCATGTTTCTGTTTTGACCTGTTCTCTGGGCATTCTAATG
CAGTATGAGGGTGGTGCGAAGGAGGGTGGCAAAGGACAAAGTATCTGGGACACCTTCACACACCAGCAACCAGGCATGCGCGCTTATGTTTCGTTACTTCTTTTTCTTTATACACGCAAA
AGCCTTTCTTTTCATAAGCTAAAAAGAACGCATTTGAATTGAGTGACAAGAACCGATATGTAGTGAACTTTTTTTATCCTAATTCTTAAAAACTCTTTCTGATCTTGGCAGATAAAATCG
CCGACAGAAGCACCGGGGATGTAGCAGTGGACTCCTACCATCTGTACAAGGTGCTAGGAATGTAGGGATTTGAATTGGATGTCTTACTTTTCCAAATGAATTATAAAGATATTTTCACAA
TTATTATCCAAGTTATTGTAGGTTCTTTATTGTATATTTTAATTTCGAGATATCTATCACAAGCATGGAAAAATCTCCCAAAATAAAACTAGCTTCATACTGATTCAGATTGGCACGCTA
AAAATTGCAGGAAGATGTGCAGCTCATGGAGAACATGGGAATGGATGCGTATAGATTATCCATCTCATGGACAAGAATTCTTCCAAGTACATGACTAGCTTATCTGGATATTCTTATTCA
TTGTGTTTCCTAAGATAAAAAAAAAAGAGGCATGTCATAGTTGATAAGACTTTCACAACAACATTTCCGATGGAATGGCAGATGGTAGTCTGAGTGGTGGGATTAACAGAGAAGGTGTCA
ATTACTACAACAATTTGATCAATGAGCTCCTGGCTAAAGGTATGCATGTCTTGATATCTTTTCCAGTCATTGGCTGAAACTTCCCTGGGCCATCAGTTTCATTCTTTGCTTCGCCTGATA
ACCTTTGAGGTATAATCTTGTGCATTTGCAGGGGTGCAACCATATGTGACAATTTTTCACTGGGACTCGCCTCAGGTACTAGAAGATAAATATGGAGGATTTCTTAGCCCTAATATCGTG
TAAGTCCAAGCTTAAGTTAGCCATGACAGCTACCAGGTTAATTGACAGACAGTAATTGTGTACGAAAAAAAGTTTAACTCTGTTTTACTTTTTTAAAAAAATAGCACGAGTGTGTGTGAA
GTGGAAGTCCGGAACTACTCATTAAGAAAACACAATCCCCTCGTGCTGCATGCATTGCACATCGCTTCTTTTTTCTTTTTCTTTATTTGAAAAACAATTGCACTTCGCTTTCTCAGTTGG
CAATTGACAGTCAAAAACTAACAGTTAAATTAGCCCCTCATAAGAAGAAAAACTCCTGTGGACTCGAATTCCCATCACCACTGTACTTATCCTTACTTGTATGCTTTTTAGTTTGCATCC
ATAATTAATGAAGATTAGTAACCAAAAAAACTAACTTACGGACATCGCAGAAATGACTTCAAGGATTACGCTGAAGTCTGTTTCAAGGAGTTTGGCGACCGAGTGAAGCACTGGATCACC
TTCAACCAGCCCTTCACCTTCGCCTCAGGGGGCTACGCCACCGGCACAAAAGCGCCGGGCCGGTGTTCCCCATGGGAGGGAAAATGCAGCGCTGGGGACTCAGGAAGAGAGCCTTACATC
GTGGGACACCATGAGCTGCTCGCACACGCAGAAACCGTTCGGTTATACAAAGAGAAATACCAGGTGTCTATAACATATATTCCGCCCAAGCCCATCCCACATGATGTTTCTGTTAGATGA
AGTCCGTTTAGACCACAATGTGGTTTGGCTCTGACAAACGCTGCTCAAATGCAGGCTGCGCAAAAGGGAAAAATCGGGATAACCTTAGTCTCACACTGGTTTGTTCCCTTCTCCCGCTCC
AAATCCAGCAAAGCTGCAGCAAAACGCGCCATAGACTTCATGTTTGGATGGTAAATTCTGTTACTCGTGCAATTTCATGGTTCAAGAAGTCTAGAAGATGGTGTAAAACTGTAAATCTTA
CTATAAATGTTCTTCCAGGTTTATGGACCCCCTCATTAGAGGTGACTACCCAGCAAGCATGAAAGGATTGGTCGGAAATCGCCTGCCCATGCTCACTAAAGAACAGTCCGAGTTGGTTAA
GGGTTCATTCGACTTCATCGGACTCAACTACTACACTACAAACTACGCTGACCACCTTCCTCCATCAAATGGCCTTAACACCAGCTACAGCACTGATTCTCAAGCAAACACTACCGGTGA
GTCGCGGAGCAATCTCTCTCTGTTCTTCGTTTTTTTTCATACTAGTGTTATTTGGTAAATGTTTATATTAATTTTAACCAGACATCAAGAGTACATTTTTTTTTATAACGACATCGAAAG
TAATTTGTGGTGAAGTCCTGAAATACAGCGTGGCAAACCCTGGAACAAAATTGGCCATTACACTATTGTCATGTCTCAAAGCGTAGCCTCCAATGCATTAATTGTTTAATCTCTTTATAT
CATTTCTTCACTTGCCTTTGATATCTGATTTGAAATTCTATGTATTTCTAATTTCTATATATCACAATATATATATATACTAACATCCTCTGATTATATTAGGTGTTCGAAACGGTGTGC
CTATAGGTCCCCGGGTAAGTTGCAAACACTGGTAACTGAGCACCTGCACACAAAAGTAATCACCAGTAATTTCACCAAAAACCTTTTTTATGCACAACGATTCATTTCCATGGATGACAT
GTACTAGGCCGCTTCATCATGGCTCTACATCTACCCAGAAGGAATCCGTGAGCTGCTGCTGTATATCAAGCAATACTACGGCAACCCGACCATCTACATCACTGAAAATGGTGCAGACTA
TATCATCCCATCCAGTAGACCTTGACATGATTTTGCAACCAAATAAGAGCCTCACAAAAAGAAAAGGAAACTAAACATCAATATTATTTTTCTGGAGCACTCCAGGCGTTGATGAAGCCA
ACAACAAGACTGTGACACTGCAGGAGTCGCTCAAGGATGACACCAGGGTGGATTTCTACCACAGGCACCTGCTTGCCCTGCTGAGAGCCATAAGGTCCGAGCACACTGTCTGATCATATC
CACACACTCTCAACAGCACGCCGTCGCTGAGATTTGAGATGGCCGCAGCTCACCGTGTCTGCTCCATGTGTGTGTGTCTTCTTCGCAGGGAGGGTGCCAACGTGAAAGCATACTTCGCGT
GGTCGCTGCTGGACAACTTCGAGTGGGGGAACGGCTTCACGGTTCGCTTCGGCCTCAACTTCGTGGACTACAGCGATGGGAACAAGCGGTACCCCAAGAAATCTGCGCACTGGTTCAAGG
AGTTCCTCAGGAAATGAGCATCATGAACGACGCTGGGACAATGCTAAGGTCTCAGTTTGTACGATTGGATTGACAGTGCGTGTACCGTGAGAGACAAGGTGTTACAATAAAAGGATCGGC
AAAAACAAAGACCATGGTACNNNNNNNNNNNNNNNNNNNNNNCATCACGGTCAATTTACAATTTACGTCCCCGGATTTGTTGCTGCACTTGTTCAAACTTTTCAAAAGATTGTGGGGTGG
GAAGTTCTTGGAGATCAGTGTGTGGGTACAGGGTGTGACACGACGACACAGTCAGCAGATGACGACGATGCGTTTGTTGTGGTGTAACGGTCAGGTGAACAGTTGAGAACGACCCCGACG
TCGTTGGTTCTTTCACTGTCAGTGTCTTGTGCCAAACATAGGGCTTTCAGGCCGGGCCTGGGTGCCGTAGCGTTTTGAGCGGTGATGACCACAGCGCGCGAGATCGGGAATAGGATTCTC
GATTCGATCTGTCTCCGTCCAAGACACGTGCAAACGCGTGTCAAGAACTCTTTCTAGAGCCCTGAATTTCCTTATGGACCATCAAATGCAGTTTTCATGAAGTAGTACCTCGCATCTACG
AATCCACGTGAGTGTCTCCTATTTTTTCAATAAAGAAAACTTTAATCTATCAAGTGATACAATAATCGAATGAAGACGGCTTCGTCAAGCTGTAACATTATATTGCATGATCCAATCAGA
AAATTACATACCAAGATTTTCAACCTAGAGACGATCAAACTCCAGACAAAGCCTTCAACAAGCCGCCAATTATGTCACCCATTCACTTCCCCAGTCATATCTGATTTCTGATATGCCTCC
CCGTATTGCCCAACTGCAATTAGCCACAAGCTACCACCTTCTTAGGCATGCCACCTAGGCCCTAGCATAGACAATGTCGCCAAGAAGCCAACAAGCACACGCTCAAAATCCATTGGATAT
GATACTTGGATCCATCAAAAAATCAAAAAGGTAGGTTGTCAATCAACACAATACATTATAATATAAAACACTGGTCTCCAGACCGGCATGGCCCCTAACCAATGCTCAAGACTTCATTTC
AGAACCATCGTCAAGCATGCCGTGATTCGTGAACACTGAAACAAAGAGCACACAGCCAGGAACATGCCAGTAGACACCCATGACTGTAACAAGATTAGATATGTAGCCTCGCATAACGTG
GACATATATAGATCTGCATGTACTATTTGTCCTGAAATAAATTCGGAAAAAATATGAGCTCTACTCCTAACCCAAATGATGGGACCAAAACTTACTTGAAATCTTTTTCCTGACTCGGTT
GCAAAACTTGCATGATACTATGGCAATCCGAATGTCTATACATCTCTCGCAATGGTGCAAATCTCGGCACCATCCTACACATTGATATTTCATAAAAGTAATAGCTCTACTCCTAACCCA
AAGAACAGAACGAAAACTTACCTGAACATATGCATTTCCTTTTTCTGCATTTTAAGGCTTTGATGAAGCCAGCAACGAGAGGCTGACACTGCACGATCGGAAAGCCTATGGGCTCCAAAA
CCATGCCTATGGGCTGTGATGTCCACAGCCAGCCTGTCTGTGATGGATGATGATGATGCCCACGGCCTCTCTCGTTTCGGTCCAGTCAAGGATGATGGTCCGTGGGCCTGGCTTTCGGAC
TTTGCATAACAATGTCACATGGCAAATCTGTAAACAACAGCAAAAACCACTCGCTCCTATCTTGAAAAAAAAGGGAGCAAACACCGCTCTCTCTGTCACACAGCTATATACTCTAGTTAC
GGAACATAAGCACTAAGTTAATCCATTGAGGGTAACGAAGCGCGCTAAAGCTAGCCAATCCATGTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATAGTGGTACTATAGTACTTATAGTTTCATTAGAAGAAATATGTGGTACTT
AGTACCCGTAGGAACTAGTAGTGATGATGTGAAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNTTAGATTTAATTAATCAAGTGTACTCCGAGTTTTGCATTATTGCAATCATATGTCATATGACTGAACTGACCAATAACGTGGTCACGGGCTCACGGGCGTCTTATTAGGAG
GTTTCGGTAATTTCTTGTCCATCGTGGATGCTTTGGAATTTCGAGTATTCTGTTCCCTTGTGGGAAAAAGAAACATGATTCTGAAGTGTGAATTATTTTTCTTTAATTTAAAAACGAATG
GATCAAAGATCAGTTGTTTGCAAATTGCAATATCTCTAATACATTTTGCAAGAGTTACAGTAGTTTCGGGTTGATGGCTCCGAGTAGCAGCGTTCCTTGGCCATGTTTTGGCAGTTTTGT
GTTGGAGTTGGTAGACTCCTTTCCTCTCTAGTGGTAGCACATAAGCAAAGGTATGACTTGTACTTTTTCCCCCCAGATCCTTTGCTGTGAAAGCTACTTCTTTCCTTCAGGATCTTGTCT
TGTACCCCTGTAGTCCTGTGTCCATGAGACATGCACTCCAGCTTGTCTTGGTTCTTCACTGTTCAAACTCGGAGCTAGCTGGTGCCACTACTGCCAGCGACACACTGGAAAGCTCCAGTG
CACTCTGCTCATCCAGTTGTTCAAAAACTAGAAAGCACACTATATTTCTGGTATCACGAAAAAAAAAACAGAGATCGACAATGCAAGATCGCATTCTAGTCGGTATTTGGCAACACCTTT
TCTTTTCTTTTCTTTAAGATGCCGTTTTGACAACACATTTTCGTTATTTCAAGGAATTTGGCTACATTCTGTTTGCTGGTGATCGGGAAGTTGCCAATTGCCATCTGACGTTGATGTGGT
TGGAAGAACCGAAGAATTATGAAAATACCTCCGTCCATGTTGTCCATTTTTCTGACAATTTTCCCCTACTAGTGATCTTTTTAGTCCTAAACTTCATGTCTAATGCTAATACGTAACCTA
CTGTAATTCGCTACTAGCAGTCCAAAGCACTATCTTTTTTTTTCACTTTTGGATGAGGTCCAAAGATATTTTGAAGTTCAAATCTCCTTGCGTCTCTCCAGCCTCTACTGTCTGCTCTAC
CATTCCAAGGTGAAAAGGCAAAAAAGAATCCGAGCAGTGGCAAAGCTGTAAAATCGCCCAACGGCTCTGACCGCCTGCCCAACAGCACACAGCCTCCACCAGCTGTCGGTGACGTCAGCG
TCCTAGCGCGGCGAGGGGACGGCCGCTCGGGCTCGGCGCCAAGGCGAGAAATCCCCGGGCCAATCCGCATGCACCGAGCCGCTCTCTCTGTCTCTCTGCATTCCGGGCCCACATACGGCG
CCAGCCGCGACGGCGCGGCAGGGGGAGCCCGGCCGTGCGTGATCGGAGCGCCAGGTGTCGACGCGGCACGTGACCGTGGCACGGATGGGGGAGGGAGGAAAGCACCTGCCGCCGCGAGGC
GATGCGCCTCCAGAGTCCAAGCCTTCCTGGTTTTCGTTGGAGCCCCCCACCAGACAGACGGGCGAAACTAACTCTGCGGCGCAGGGCAGGGCAGGGGCAGAGGGTTTTGGAGCAGAGAAA
GCCTCCATTTTTTCCTCCTCCATCTCTTCGCTTTCCTCGCGCGTGTTAGCGGCCGCCCGCGTCCGCGAGCTCGGGTCTGGTCTGGCCGGATGGCTCGCGCGGCCATCGTCGCCGTGCTCG
CCGTCGCCGTCCTCCTGGCCTGCTTGCCGCCCGCCGCCGCCTCCTCTTACCGGGCAGGTACGTCCGTGACGCCCACTCATCGCTTTCGTAGACCACGTTTCTTGGCTCTTTCGCCGCCCC
GAAACCCTGACGCTTTCCCCCTCTCCCTCGCCGGCGGTGCAGCAGCGGCATTGCGGCGGCTCGAGACGGCGGCGCCCATGGACACGGCGCAGGGCATGCGGGAGAAGGCGGACGTGGCCA
AGGTAAAGAAGCGCGCCGTGCTGCGGCCTGGGATCAAGAAAAGGCGGTTCTTTTTCTGATGGTTTCTTTCTCCGCTGGGGGTTCTCTCCGGCGCGCAGGTTGCGGCGGAGGACGTGAGCA
CAACGGGGTTCGGCGCGGAGTCCGAGAGGGAGGTGCCGACGGGACCAGACCCCATCCACCACCACGGCCGGGGGCCAAGGAGGCAGTCGCCGTGATCGCGCGCGCGGCGGCGGAGGAGGA
GGAGGATCCTCGCGTCCTGGGAGTTGTGATCTTGATCGGTCGTCAGGCGTGGACCGGATTCCACGACGATTGTGTTCTTTCTTTCTTGTTCAATTGAATCTGTGATGCCCTTTTGGTTCC
TAATTCCATCGTTGTAGTAGGGGGAGACAGCATCAGACATTACCTATCATCCAAACTTTGTTTCTGCATACCAAATTAGGGAAAGAGAATATAATTCATAATAAGTGTGTACACCATGTA
TGAATTGTTCTTCTTTCCCTTATAATATTGTCAGTTTGTTTTGTTGCTGGTTCATTCTTTGACATTCTGTTTGGGATCTCTGGTTGTTTTGATCTATAAATTGGCAGCTTGTTTTCAAAC
ATCTTTGGCGTTGAAACTTGATGGTTAAAGTTCAGATTGGGGGGTAGGAATCCAGAACTTCTGTGCCTTTTCCCCGTTCCAGGAAGAAAGCAACTTTGTTCAGTTCTGTGCTTGGGCAGG
GAAAGAGTGCATGCCCACTTGTCTAGAATGCATGTGTAGGGCCTCTGTGCAGCTTGGCTCCAAGCTAAAAAGGAGATCATTTTTCATTTTCTTTGGATTGTTCTAGCCTGATTCGCTAGC
ATTTTTGCAGTTGCAGCATTATCAGTTGTTCTTTGCCCCAGCAACGGATTAATATGTTACTAAAATCTAGTACAACGTTTTTCTGAGTTATATTAAAATGAGTCTTATGTACCCAGAAGT
GTAAAGGTTGCATTTTCACGTTATCAAATTGAATCCAGTCAGTGAGCGTATCAGATGGTGCTTCATATATATGCTTTCTCTATAAACAGAGGTGTCTGCATGATGTTTTCAAGGCTTTCA
GATTTCCAATAGCCAGAAGTTGTGGGCAGCTATGGATTTTGGTTTGTATGCTCAAGAATCAAGCATAAAAAATAAACATGATGACTTGGACTTGTTAGCTAAGCATGGCATGATGCTAGC
TTACTTTCCTTCTGTTGCATGATTAACCACTGGCATTGCTTATTTGCTTGAAATTCGGCAGGGCTGAATTGTTTGTGGCGTGGGCAGGATTTGAATAGTGCTTTGTTATGTCACTTTCTG
ATGAAACTTTGGGAGAATGTGTTACACAAACTGTTGAAAGTGAATGCTCGCTTCTTTCTTTTAGGAACTCAAGGAACCGCCATGAGATCCATGGATGCTTGCTGAATGCTGACCGCACAA
TTTACCATTGCACCGGCAAGAGCGCTGTGCGCGTTGCAAAAGATTCATGATACGTTAAGAAATAGATTAAATATAAAGACTTCGTGATGTGTCTTGCAGATCGTATTATACTAAAATTAT
TGTACGAGAAAAAAATATAAATTAAGTTGCTTGAAATGAGAAAATTGAAAAGTAGATTTACCCCGTTTTTCAAGAAAGAAAGAAAGTAGATTTAGGAAAAGGAGCACCAGACTCTTTTTT
TTTTTTGGAGAGGAACCAGACTCTTAAGTGTGAGCCATAAGCCCACAATCAATCAAGAAATATGGCCGATAGGCCCAACATCCCGGCCCATCAGGCTCCACTCGACGACTAGGGTTTACC
ACCTCTCAATTCCCCACGCCGCCGCGAGATATAAAAGCCGAGCCCTAACCCCCACCCCCGCTTCTCTTCCACCTCCGCCTCCACTCCCTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNGAGACGATCCAATGGCGCCGTCGTCTAAGCTGTCGATGGGCATCAAGAAGGCCTCGCGGTCGCACGCGTACCACCGCCGTGGGCTGTGGGCAATCAAGGCCAAGCATGGCGG
CGCCTTCCCCAAGGCCGAGAAGCCCGCCGCGGTCGCCGAGCCCAAGTTCTACCCCGCCGACGACGTGAAACCGCGCAAGCCCAGCACCCGCAAGCCGAAGCCTACCAAGCTCAGGTTCCC
CGCGACAGCATCATCGTCTCTTCGGGTCGAATTGCTTGCTGTGAGCTGCGAGTACTGACGGTTTCTGATGCGTGCAGGTCGTCCATTACTCCGGGCACCGTGCTCATCCTGCTCGCCGGG
AGGTTCATGGGGAAGAGAGTCGTGTTCCTCAAGCAGCTCAAATCTGGCATGCTCCTTGTTACTGGTGAGCCTACGTTGCTAATCAGACACAGTTTAGTTGGACTTTCTGTTTATTGCTTC
GTGATGTTTGGTGTCCAATGCTCAAAGTTTAGTGTTTGTTGAATATGTGATGAATTAAAGAATGAATGCGGAGTGTTACAAATGCATTATTTGTAGGGAATGGCTATGTTGACTGCTTCA
TGTAAGCATTTACCTGCCTTTATTCCGTGGTGGAATGTGCTAGATTGAGGGTCGATTATTGCTGTTGTACTGAAGCGAACATGCTTCATCTTACTATTGACTTGTTTGCTGAATGATATG
AAAATCTGCATTGCATATGACGGAAACCACATGTATTACTTGCTTAAAATTGAGGTCACTAGCATATTGCAGTTCCATGCTTATATTTGCCTGTGAGTGTAAAATTAGTTGTTGCAGTGA
CACTGATTTTATGGACTAATGTTATTTAGCAATGGAAGATCTCAACTGAGTCTGGCAATTTTGTTGCATTGTTACCTGGACCAAGGGTAGTTGAAATGGTTTGCTAGTGTCTCACTTTCT
GTTCTCCATCTGCAATACTTTTTTTCTTTTATTCTTTTAGTTATCTTGACATGTTACCTGCAAATAAATAAAGGATAATGTTGTCATGTTTCCAACATCCAGTGATAAATACTTGCTGGA
TGATCATGGTGCATTTCAATGAAGTACTTTTACCAAGAATATGTACAGTTGTTTTGCTTTAAGAGATATATTATACTGGTTTTCAGACCATAGGCTAGCTTTGACACCTACAATTTCAGT
GTGCATTTGCGAAGCAAATACCTGTTTAACATGAATATCCCTGAGACTTGGATGATAGGGAAGGTATTAAAACTTTGATTTCTCTTTGTCACTGTTGCTGAGGTCATTTGGTCATGCACA
GTTTACAGCTCTACTGATGTATATTTATCATTAGTTGTTATATGGTGGAGTAGGATCAGTATGTTGCATTTGTTTGTGGCATGCTAGTACCAGCTAACAGGGTATCATCAAATGCGAATG
GATTGTTATATACTATTAGTTTTCTAGACTGTTTTGCATGTTTTTGTCAGTGTTTTTTTTATCTCTTGTGTATTAACTAATATTTAATATTCCGTCTTTCAGGACCTTTCAAGATCAACG
GTGTCCCAATCCGCCGTGTGAACCAGACCTACGTCATTGCAACCTCCACAAAGGTTGATATCTCGGGTGTTAACGTGGAGAAGTTTGATGACGCGTACTTTGCCAGGGACAAGAAGCAGA
AGGCAAAGAAGACCGAGGGTGAACTTTTCGAGACAGAGAAGGAGGTGTGTTTCTATGCGGTCTGAAGCTTGTTTTCCTTTCTTATGCAACCTTGCATTGCGTTACTGAAGGGATCTATCT
GTATCTTTCAGGCGACCAAGGACCTGCCGCAGTTCAAGAAGGACGACCAGAAGACCGTGGATGCTGAGCTGATCAAAGCTATTGAGGCTGTTCCGGATCTGAAAACCTACCTTGGTGCAC
GGTTCTCTCTCAGGGATGGCGACAAGCCCCATGAGATGGTTTTCTAGATTAGTTGGTGCTAGGTGCGAAGCTCAATAGTCACTTTGCCTGGTCTACCTGAGTGTGCTCCTGAATTTTGTA
TCTGACTGGTGAACCTTTGGTTTCCATTTGAATCACTGTCAAATCTTTAATGAAGTCATATATTTTGCTGGTTAATTTAGCGATCTTTTGCACGACACTACTATACATGTAAGCTATTTG
CAAAGTCCTGTCCTGGCATTTGTGCATTCTTCCGTGGCTTTGATCACATGAGCAGGAGTATGATCTATTCAGATCTGTGTCTCGTTCTGTGTTAAATCAGTTAAGCTTGTTATCGCTTTC
AATTCAGGTGGCTTAGGTGAACTTGTCTCACCATTTTAACTGATGTATCAAATTGTGAATGTATTCTGATTTCTGACTATGTTTTGGTTGCTGAATGTGCTATTTTGCTGAGGAATCTCA
ATTTCAGTCATACTACTGATGAGTGATGAGTTTTGAATAGGGTGATGCGGAATTACTGAGATCATCAGTGTTTATGGTATATCCTTGTATGATGCGCATCTGAACATGCATCAAGCATCA
TGGCAATAATAGTACGCAGCAAAAAATAGTACTCTTGTTGATCACGAATGCACTCGCAATGAACTGCAGGCTGTTGTGCAGGCTACAGTACATTTGAAACTGCAGGCCGGTTTGCAATGA
AAATGCCATACACGAAGTGAGCTGCAGACTACAGCATGGTGTCAGCCCGGGACGGCAGCCTCTTGAAGAAGTTGCCGGCAGCCGACGGCATGCTGCTCCTGAACCGCGGGTGGCGGAGCA
CGTACAGCCCGGCGACGAGCGCCACGACCCGGATCGGCGTGACATAAAACACGACGGCGGCGACGAGGCAGAACGCCGTGAACATCGCCGTGGCCCTCGGGTCCCTCCACGCAAGCAGCG
ACCGCACCCGCTCCCCCTGCGTCGCCACGTCCCCGACCACCGCCTGGATCCGCCCGGCCACGCTCCGCAGCCGGTCGTACCGCACGCGCACCACGGCGTTGGGTCTCGACGTCGGGAACG
TGTCCAGCTCCTCGTCGAGCTCGTCGGGGTGCGCCGCCTCGGCGCACGAGAGCCTCGCGTCCATGTNNNNNNNNNNNNNNNNNNNNNNNNNNTAGTTCCAGAGGCCCGCGGCGGACATGT
ACAGGAACACGGTCGGCAGGATGAGCTCCGGGAAGCACGCCAGGGTCACGAACAAGACGTGCGTGAGCACCGTCGTCGCCGGGTTCCTCCAGCGGCACACGTCGGCGAGCCANNNNNNNN
NNNNNNNNNNNNNNNAGAGCAGCGCCGTGGCGCGGAGGAAGTTGGCCTTGCTCCGCCGGATGCTCCACGCGTGCGAGTCCGCGTCCAGCATGTACTCCACCACCTCCCGGCGCAGCGGCG
GCTCGGCGCGGCTCAGCCTCGCCGCCACGATGCCCGCCGCCTGCCGCCGCAGGCTGTCCAGCTGCTGGACGGTGAACGGGTGGGCGTAGTGCATCTTGGGGAGGAAGGGCTGGCCGTAGA
GGTGCACGACGCTGCCGAGGGATAGGCAAGTGAGGCGCACTGCGAGGCAGAGCTCGCCGTTCTTGCGCAGACCGGACGCGTGCAGCGTGACGAGCGGGTGCGCGTTTGTGTACACCCTGT
CCATCTCCAGCGTCGAGAGGCGGATCCTGACCTTGCCGATCCTCTGGTCCCTGANNNNNNNNNNNNNNNNNNNNNTGGCGTCGCTGCCGAGGTGGCAGTTGTCGAACACGGCGAGCGTGA
GCACCGTGCACGGGTCGTAGACCTCCCACGTGTACTGCTCGTTCCACCGGGGACTGCACGAGTCCACGACGGTGCGCGTGCGCACCCACTTGTGCCCGTACTTGGCGACGCAGTACGCGT
CGGTCACGCCCCGGCCGTGGACGGTCTTCGCCGGGGTGAGCCCCTGAGCGCCGAGGACGCCGACCTCCAGCACGCCGACCGGCGGGCGCCACAGCTGCCGCGCAGTCGGGCGCGTGTCAC
TGGCGTACATGGTCGGCTCCTCCATGACGTGGTACGCGCCCTCGATGCACGCGCGGAGCTGCACGCGGCCGGCGAAGACGGCCTCCGGCGGCGGTCGCACCGGCCGTCCGAATGGCTCCA
GGCTGAACCACAGCGCCTGGACCTGGCGGCGATCCATCCGCTTCTCGAAGACGGTGAGCGGCAGCACGGCGCGCCCGATGATCTCGTCCTTCCCGGGGTGCGCGCGGGCCTCGATGATGA
GCACCGCGGGGTCGTCGAACGGCTCCGCCACGGCGAACACCAGCTCCTCGTTCCACGCCAGGCTCGTCGGGCTCCTCGCGATGCAGGGCCTGGTCCTGAGCACCACGCCGCCGACCTGCA
CCTTGGCGAAGACCTCGGCGTGACGGCCTTTGTCAGCGACGCCGCCGGCACCGAGCGGCACGACGTCCTGAGCCTCGAGCACGCTTACCCGGAGGTACCACAGCTTCGGCGTCACGTACA
CCTTGCCCCGCGTGCTCTGCACCGCCGCCGCGCCGTTGCCCCCGCGGACCGGCGCGGCGTCGGTGTGCCACGCGTCCGCGAACACCTCGTCCGCCTGCGTGCCGACCCAGACGGCGAGCA
TGACCTCACCGCTCGCCGCCATCTTCCCGCCTGCCCCCTCGAGGCGGTACCACTGCGGCGCGAGCGGGCTGTCCGGCGGCACGCGCATGGGCGCCTCGGCGATGTCGAACGCGACCCTGC
CGACGCAGCCCTCCCTGTCCCTGACGAGCACCTCGAGCGCCATGGCCTGGACGCGGTCCCTGGAGAAGGCGAACACCTGGTTCCACTCTGGGTTGGCCTTCCCCTCGAGATGCCGCGTCG
CGCCGCGGTGGCTGCCGACGCGCAGCTCGACGTAGGGGCAGCACCCGCCGGTGACCGCGCTCGCCGGGAGGCCGCGCGCCTTGACGACGCGCACGTACAGGTAATGCATCGTCTCCACGA
GGTCGTAGGCGCTCGCCAGCCTCTCCCCGGAGCCAAGGCCACCCAGCCACCCGGCTCCGGCGCCATGTGGGCTTGCGCTTCTGCTGGCACCGGCCGGCCACTGCTCCCTGGCCTGGGGCA
CAGGCGCCGCCGCGTCCTTGGCGGCCTTGTGATCCTCCACTCTCACTGGCGGCGCCTGGGCGCGGAACACATTCGGGTACGCCATGATCGGAGAGGTCGGCAGAGACAGTGGCACGGGGC
GTTGGCTCTCAACGTGTCCGCCTGTCAGGTAGGTGGTCGGCTTCCCCGTCGCCGGCAAGGGAAGGCGTGCAAGGTGGCACGAAGCAGGCAATGGACTGTACAGACACTTGCAGAATCTTG
ACGCAATTGTGGATACGGGAGTAAAGCTGAGGTCATGTGATTCGAGTCGAGGTGCGTCACGACGAGTTGGTGGGGGTGCATCTGCCTGGATTTGAATAGGACCTAGGAAGAGGAGTGTTG
GTGAAGACTCCTGAGATCGTTCTCAGGAAACTGCCTGTATACGCAGCTGCTTTTCTGTATCATGTATTCCTGGTCAGGTAACTAGTTTAAGAGGATGAAAGACTCATGGCAATTTTGATG
AAAGTAGTTGAAACAACCATTCTCAACATCTCTGATAGTCATGTTTTCCTCCCGGAAGACTTACCTGTGGAAATTATCAAAAGAAATATATACTGTCAGGTTTGGAACTGAAGTGTTCAG
AGTTTTTTTAAAGGAAGTATTCAGAGCTAGCTTAGCTCAAAAATATATAGTATGTACACAGACCATAAATCATTAACTTGGTTTATACGGGAATTACACTACAAGATGCACTGTCGCTCT
TTAATATCGTACATATGAGAAAAAATAAATCACAACACAATTTTCTTTGATCCAGGAGAATTTTCTTTTCTTTTTTTGAAGTAACCAAGAGATTTTTCTCGGCTGGGTATTACACACTCC
CTCCGTTCCAAAATATAACTACGTCTAGAGTTCAAAATTTGTTCCAAAATACAGCTACGTACGTTTGAGTTGACAACTCTGATTGAATGGATGAATGGACAAAAATAACCCTATGGCAAT
CAATTGTCTTGTGGTTCTGACTGTCAATAAATGGCAGCATGCACGATACCTTTTATTTGTGTGGAGACATATAAGGAAGGTATAATTACCACACAAAAAACACATGCGCACGAATGGACA
GGTTTAATGAAGGACATATTAGACATTTTAGCATTCTTCTTAATATGTCTTAAAAAGGCTAAATGTAGCTATTTTTTAGGACGGAGGCAGTACTAAGCTACATGATGGAACCAAGAGGGG
GGAAAGGGCAAAGTGTGTACTTGTGTTGAAAGCAAAAGCAATTCAGAGCCTTTGGGGGGCCAGGTTTGCTTTAACCAAAGAAGCCCCTTTATTTTACTCTATTTTATTTTTTTCACACTG
GAGCTTTATTCTCCTCGTTGCAATTGAAGTATTTTGACCGGCGGCAATGGAATAGTGCTGTGGGCTTAGGCCGTTTACCTTTTGCTTACTCCTGCTGGACAAGTCCCAGCTCAATGTAGG
GTCTACTGCTTCCTTCAGAAATCAGACCTGAATGTTCAGGAAGAAAAAACTAATGTGATATCGAGGCCTTTTGAACTTTGCTGGTCCCTTGGTTTCTTTCTCGATACTTCATCCATTGCT
TTCTTTTGTTCTCATTTTGCTCATTGCCCTGAGTTTAGTATGCTTGCTTTGCCAAAGGTTGCATGCTTCCACTAGACATTTCCTTTACTTGGCTAATTCATGATCATGAGGACTAGACAC
TATTATAGTGCTGAACGACGACCAGCTAGGCTCTACCATGTGAATCAGAACAAAATCCCCTTTAACTCGAGAATTTACGAAGTGTAGTGCCAAGTCATACGAACTCTGCTATTTTTTCGT
TTGTAATTCAAAGCTGTTTTTGCGATGAATTCATGAGAATGGTAAACGGGTTATGATTGAAACTGGAAGGCGCCTTTAAGCTTTTGTGACGGGGAAACACGAGGAGCCGAAGATGAAAGA
AAAAATGAACCAAAATTATAATTCCGAAAGAGAAACATGAAGTCGACTGAGCTGAGTTCGTGTTTGTATTGCTTCAGTTGTTGGTCTATGACTGAAGAACAACACAGAAGAATACCTAGC
AGAGTAGCAGAGCTCCTCGTGTCGTGCTGCTCTGCTCCTTTCCGCGGCTTCGGTGGCGCCGGGTGGACATGGAGGGCGGGCGGCGGCGGCCGCATATCGCTTGTTCGGTCGTGAAGCGCT
TCTGGCGGGGTGCGGCGGTTNNNNNNNNNNNNNNNNNNNNNAACGAGCCGCCGGGGCTAAAGTGCAAAAATCGACCGGAATAAAAGTATTTTAGGGTGCTAATGTAAAACATTGGATCGC
GATTAATAGTCACGATCCAAATTAGGGTCCTATTTGTAAAGTTTTGGATCGCGATTAATAGTCGCGATCCAAATTAGGGTTGTATTTGTAAAAATATAGGGCTAATTTGTAAATATCGGC
TGCCGTCGGCGCCCGCCGCAGCTTCAACATGGAGATCCTCCGGGTTCCGGCGGCGTCGCTCCTCAGGGGCTCAGGGCCTCGGCAAGTGTTTCAACCGTGGATCCAGCCAATCCTCACACT
CTATGCGCGTCCGTTCCGCTGTCGCGCGCGCATCGGCATTTGTGGCGGTGGAGCGCATGCGGAGCCGCTGATGGGGACGGCGAGCGGCCAACGTTGATGTGGGTGCGCCGCGCTGTCGCC
GGATCCCGATACCATCCAGCTCCTCTCCGACCCTCTGATGGGTGTAAAGCTCGCACCGACGAGGCGACGACCGAGCTCCTCGTGCAGGCATAGCTCGGAGAGCACGCGGCGCACCACAAG
CTCGATGATTGCCTGACACATTTCTCTTCATGTAAGTTATGCGTGAATGCATTTCAGTTCACAAAATTGCAAGGACTAGCTACCGATTTTACTGTTTCTGTTTCAAAACGTTTCCTCACT
TCAGCAGCAGTCCAGCAGATTTTAGTACATTATTGTCTGAACCTAAGAGCTAGTCTCAATTCTCGTATGTGTATGTCATATGTAGTAGATATAGCCTGTGGTGACAAATTTATTCATACT
CAACTTTGCCATTTTGCGGCGTTCATGGAATCATGGTTGTCTTCATGTTGTTCTCGTTTCTATTAAACTGAGTGTGGTGCCATTGTTAAATCGTCTCGAGTACTACTTTATGAATATGGA
GAATTCAGAGATCTCATTCTGCACTAATTTTGATGGCGTGTCATATCAATAATTCTTCATATTCATCATGAAAGAATATAGATTTAAGTAATGCAACATCTTGGCCTAGGAACATATAGA
GGATTCTCATAGTTTTGTCAAGGATATGCTTTGCTAATAGCATGCCAAGAACTGGTGTGTTTTTTTGGCTTACCTTCACTGAAACAAGAAACTCTCTGTGGATGGTTTATTGGATTTCAT
AAGTGCTCGTAGAAGAGTAGGGGAATATTGCTTTGCTTTAGCAGAACCCTTCCAAGGCAAAACACTGAATTCTACCTTTTCCACATTTATTTACTATACTCAGAAGAGTGCATTACCTGT
TTGAGTCCAGCTTATTTGTGTTTTGCCTAACTATATCACCAAGCTGGCATTTGTCCAAAATCTGACCAAAAGAAGGGTAGAAAAGAACAGATTTCTGATAAGATGCTGGAAGAAGAGTGT
CTTCCCCCTAATCCTACTCCTTTTGGTAAGTTTCCTGTTCCTATTCTGTTCTATATTTACATATTTCTTTAGACTGCGAATTACGACCAGGTTGCACTTGCTGTTAATACAAAAAATTTG
CCTCGGGTTTAAGATTATATGAGAAGTCTCAAGCGTAACTTTGCAACTATACATTAGGTGCAATTTTACTTGGTGGCACATGGACTCTTGATAGATAAGCACAAATGCACAATCACTAGC
ATGAAACTCTACCAGGACATACTGTTACCAAAATTTGAATTTGTTTGCAGAAGTTATTGTGATTCATGACTTTTTGTAACATGGACAATGACAAGAACACTAACAAGTGTGTCTATTCAT
CTGGCAAATGTGGCACGATGGTCTGGAAGGAATATGTTGACCTGAACGCGTTGTGCATGGTTGCACATTCAGAATTTGACGAGACTACAGTAATAATGCCTTCATGGCAACCTTGATTCT
CAATTACATATTGCCATTTCCATTTAATTTCCACTTCGTGGTTATCACTAATAAGTTTATAAAAACTAGGGTGATGCAATCAGTTCTTTTCCCATCAAGTCTACTAACAGTGGTGGTTTT
GTAAGTGTAGGGTTTGAGCCAAGGGAAAGATCTCCCAGAAAAGGAAGGAAATTATTCCTCAAAATGGTGCGCATGATGTCGATAAGTTGGACAATGTAACTGAGATGCGGGCCTACTCAT
CTTCTGGGGAAATCCAAATCCTTCACGTTAACATGCTCGTGCTCCGGGTCGCAGATTGATCCACGTACACTTCAGCTGTCTCATGTACATTGTCCAACCAATCTGCGGTCTGGAGAATCT
CTTTGCCTTCTTCGAAATGCATTACATATGTTCCTAACCCTGCTGAATGAATATGTGTGCTGCGCTCCATTGCTCATCCTCAAATTCAGTTTTGATGCCATGAAAATATCCAGATATATT
TTGTCGAAGAATGGGCGCTGTAAATACTCTGCAGCATGCAGCAAGTGTACATTAGTGGCCAGCTATATGATTGATTGGTTCATCGACTCACTTCTATGCCAAAAGTTGTGGTTTGGAATT
TAGTTACTTTCAAGGATTCTGGTCTTTCTCCATTGATGGGAGCCTAGCTTTTCTGGAAATGACTAGTGCATTTGCATGGATCATGAAAAAACCACACCTAGAAACATGGGAAATTTTGCT
GAATGAGAATGTAATATGATATGTAAACCGAAACGAAAAGAAAGAAAACGAATATGAGAGCCGCGCAAAATTGGAACACGTCAGTGGTAGTGTTACAAAACTTTGTACAGAGTTTCATTT
GATGGGTCGGCCATCAGTTGCAAACTTGCAATACACAAAAAGCTTGCGGGGGGGGAATTTTGTGGGCCGCACTTGTTGTTGATGGGCCTAACTAGGCCGTTGGTTTCATTCCGCCGCCGC
CGCCGCCACGCGTTGTTGCAACCAGCCCACCTCCATTTTCCTGTAACCGTCCACTCAAAAATGTCGTCCCGGGTGTGTCTTTTTTACCTTAGCTGTGTGCAGGTTTTTGTGGTTAAAATC
TATTTTTGCAACGACCACTTAAGAAAATAAATGGGTTACAATTTAAGCTTTGCTAGAATTTTGCATTACATGGATGCAACCGGAGGGCTGCACAAGAACACATGACTAGAACATAGTGAC
TTGGGCCGTGAACAACAAGACGATCTCTATAGCTAAAAAAAGTAAAACCGGGGGAAACCGCGGCTCGTCATCCCTAAGGGTGACCGGGCAGACCGCCGCCGCCACACCTATAGCCCTCCC
CTTCTCCATCCCTCCACCTCGCCGCTGCCTGAGCGCACTGCAAGAAGCCCGTGCGGGCACAAGGACGGCTGCTGGGGGCCTCCTCCCACAAATCCCTTCCTTTCTCAAGCATTCTTCCTC
CAACAGATGACAACCATGGCCGAGCACACTGTGGTGGCTGCAAGCAGCCCTGCAGGTCACCGACGGTTAGATCCGCGTCCTACATAGCAGGATCTAGCATTTCCCCACGCCGTCTAGCGA
CCTACCTACTAGCTACCGTCGTCGCCGTCCTCGAGGGCGATAGCGCCACCATGGAGTGAGGGTGGGGTTCCGACGGTTTGAAGTTTCCCCATATGCCCCCTCAGTTCCGTTGGAGCAAAG
GACTTCGACGACAGCTTGCTGCTGCGACATCCTGCGGTGGGGACGGGCTTCCCCCAACTCCTCGGGGGTGGCTGTCGTGGAGCTCATTCCGGTGTTGCTCGGTGGCGCCGAGTGGGGGCA
GCATGGCTGATGCGGCAACAACATGCGCTGCCATGCCGGCGGCTCGCTGCGTCCGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTCCGTTAGGGTGTGGCTGCTGCTATGTACCTGCAGCAATCGGTCAGCCCCGGTGATGCCGGCGAGGTCTTGGCGGCTAGCCTATG
GTGGGTGCTGGGCGAAAGCTTTGCCTAGCATAATGCCAAGGCTGGCAATGGTGATGCCTTGGGGCATCATCTTCCTTCTTGAAGGCGTCGTCGTAGCACCCTTGCTCCAATTTCGCTCGG
GGGGACTTTGGGTGTAAACCCATTTTCAATCTTCCAATTCAGCGATGGCGGCGTGTGTTCGACGTCGTCCCCGCATCACTTTGGAGATCCCCTCCTGCCGCTTCTCGGGACCGCTCATGG
TGATGCTCGTTCTCTTATTCTGCATCATCCATCCATACACTTCTTCTATCGGCGGATAATGGTTTTCGACTTCTATCGTGGTTTGGTGAGTGTTCCCCATTTGGCACCTCTACTAGTGCC
ATCAAATCTTATGCCGGGTGGTGTTTCCACCTCTACTACCATTCCCCTCGAGGTTTCCTCCCCTTGTACGGCGTTGTGTGGTAGCACGTGGAGTCCAGATGTGCAGCGAATGATGTTAAT
GTCAGCTTCAAGGGAGGTCCTCTGTCCAGCGCGTTTTGATTTGCTTGCTTCCTGCCACCTTTGGTCCCCATTTCGTTGGCCTGACTCTTAGATGGAGGGTGACAACAAAGGACGTAGTTA
TGAGGGGTGGATGGATATGCAATGGCCATGATGTACCTGGTGAGCATGTTGTTCAATGGTGACTCAAATCGGGAATCGATGGTTCTTCAGCCTGAATCATGGCCTGTTATTTGAAGTGTC
TGTGTGAGTATGTATTATGTTTCTACGTTATGTTGTACTCTGGTTGTAAACCTCTCGTGTTTTTTATTGCTAAAAATCTTGTACCGGTTTTGACGTAAGCTTACAAGGGCTACCATCCAC
TGCAGGAAAACAAGAAAGGAAAATGAGGCACCTAACAGGAAAAATGGGAAGAATCAGATTAATGCCAAAGAACAAAAACATAAGAGCAAGAGAGCATGATCCTAACTGATTTCAGTTATG
GGTCTTAACACTCTTACGCCTGAAGGACATGGTTAGAGAAAACATTTGACAGTAGAAGCTTATGAATCATGACCAAACTTGTTGTGACATAAAACTCCATACAAGCAGCCACAACAGAGA
ACATTCAGACACTGGTGGCTATGGTGATATTGCAGAACAGAAGAAAATTCAAGATTTCATCCGTTCGACCACCCACTGGGATACACAGAAAAGTAAGCATAATTATACAAGACTACAACA
GTAGCATGGACCATATCACACCTCACAATAGCAGCTGCAAATCCTACAAACTCAAGCAGAAAGCCAATAGCCCGATATTCTTTGGTCCTCGAGAAGAGAACCAGGAATGCCCATAGGCAT
CACATCATGCCATGGCAAGTGTTGGAAGAAGAGCAGCAGTGGCAGAGCATTGGCACGTTTGGCTAGCAGCTATGGAAGCAGCAGACAAAGTGAAGGAGGACAAGCCTAAGGTGGACTTTC
TCCCCTCCCCAACCATGAATTACAGCCGCGAATTCATCGCATGGACATGAGATTGCGCCTCTGGGTGGCCCTTCTAGAGGCCTGAGCAGCCTTTGGTGTTCGCTTCAGGTTTCTCCTCAC
CAACCTCTCTATCTTCTCTATTGAGGTGGACAGTTTCTTTTCGTCAATGCCAGCAACGGCAGGATCCATGGGTTTGGATGGAGTCTTCGATGAGCTTTCCGCTGGCGAGGAAGACACCTT
CAGATTATCACCAGCCAAGACAGTTGCAGGGCTTGCAACAGTTTCTCTTTCAGTTGAGCCAGAACCAGAGGCAACTGCCATGGAAGCTTCAGCGCTGTGAGGTGCATCCTGCTCTGCTTG
TCCTGGAGTAGTCACGTTTACGGATTGCGGAGACTGCTCAGGCCTTTGGCTTTGCTGCTGAGCAGCAGCAATCCTTAAACGGCTTCTCTGAATAGCCTGCATGCTAGTCAGTCAGAATAA
GATTGCAGCTATCAAGGGGCAAAGACGTAAGCTGAATGCGTAGTTCAGAATCTTGTAATGAACTAATAATGCAGGAATGAGCTTTAGGATGCCTTAACAAATGAACCAGAATATTGACAA
AACAGTAATGACAGCTAAGTGAACAATTTAACTTTCGTGATGACATATATAAATATGTGCAAAAAAGGTAAGTGTACCAGAGGAATCTCTAAGCAGATGACATGTGCACTTTAAAATGCA
GATCCGCTTGTAAAAGGTAAGGTTGATTAAAAGTAAGCCAGTCCACCCAGCAAATGGACATTCAGAATATAGTTGGAAGTCCAGCTATATGGGCAATATTTCAGAAGCATTTTAATTTTG
GACATACAAATTGTACATTGCACAGTAATAAGATGGAAAGCACAAGGTGATGAAGTATAGCTTGTACTCCATTTTGACTGGTGCCAATTTGGTCAGCTTGTTGAGTCAAATATTCTCACT
AGATTCATCAGAATATCCCAAAAATTAAAGGACACCTGAAAGTAGGAAATTGTATGGCAGATTTATCATCCCCCATTAAATACTTGCTATTGACAGTACTATATGGTTTTAACTTCACTA
CATAAACAAAACAAAGAAATGTTTTCAAAAGGATCGATGACAGCATTCAGAAGCTGAAGTCCTTATCAGATGGTATCAGGCACAATAACTTTAAATGATGAACCAGTACCACTGGCATCC
TTTTTACTCTATCTCGCACTCAACATAGGTCGTGGGCTCATGTCTCTGGAACTATGGGTATGCTGAAGTTAACAGGGGACTAATCTGGTAGGATTCCAGTGATCACCATAAGAAACGAAG
AATGCTACAATTTCTATTTTAGTACTGTTCAAGTAAAAATTCCTTAGTACAATTTGTTAGTAAAAGCGCATCACTGCAGTCCAGTAAGGCAAATGAATAACTGTGCTGAAATCCCGCAAG
CCCACTTTGGCGACAACTGTACTCTGATTTACAATCAGCAGGTCAACTACAATTGCAAATCTTCGAATGGTTCAACATCTCACATCATCGCAGCAATGGAATACTGTCCGTTACCTTTGC
AATTGCCGTGATGTCACGGAGCGGCGTCCTGGGATACCATTCAGGAAGCGGGCTCCTCCTCTTCTTCGGCGTGGCCCTCAAGGCCCAAACCGGCAGCAGGTTCTCCTTGTTCCTCGAGGG
CGAAATATACCGCCGCGCCAGCGGCTTCCGGATGCCTCTCGCTGCCAGGGATCCCGGCGAGGCCACCCTCCTGATGAAGAACCCGCCGCCGCCAGCCCCGCCGGAGAGGTCGGCGAGGGC
CGCCCTCCTGCCGTCCGTGGACTCGGGCATCTCGGGGGCCCTGCATGACGCACACAGCGGGGGAGAGACATATTGGTGAGATGAGAAGCCAGTAAACGCATCAAAAAGTGGAGAAGGGGG
CCAGCGGCGAATAGCGGCCGCTGGGACGGGGACGCGGGCGGAGGCGAAGGCGCGGCGGCGGGTGGTGGACCAAATCCGGCGACGGCGGTGAGGTCCGGAGGTCGCGGGATGGGAGTAAGA
GACGGGCGCCCTGGACGGCGCTGACTGACCTGACGGCGGCGCGGCGGGCGACCGAAGCTTCCGAAAGCCCCCGCGCCCCTCCCTCCCTCCCACCCTCCGGCGACCAAGGCAGCAACCCAA
AGTTTCTCCCTTTCCTCACTTGCCTGGCCCAAATCTCTGCTCCGGCTCCGGCTCCGGCCGCTGATCCTAGAGCTTCACCATTGCAAAAAAAAAAAAGAACCTTGAATCACATCAGAACAC
CAAGGAATGGGAGGGAAAAGGGGTCTAAAATCCCGAAATTTCTCACAGTTTGCTCGGCCTGAAATCCAATCTGGGCGCCTGGCGGGCGGAAGGGTGTGGTTCCGCCCCGGTGGTGGCGGC
TCTGGTTCAAAAAGGAAGAAATCCGAATCGAAAATGCGAGACGCGCGGGATGCCGAAATTTTGCGCCAGAGCTCGAAATTTTCCTGGTACGCGCGGGCTTTAGCCGCCCTGAGTGTTTTT
CGGTTCGAAATTTTGAAACGCTGGCATTTTGCTCCTGCACTGGCTGCACATGCGTCACGTGCACCTGGGTCTGGGCCCTGCCCCGCGCGCGCGCGCTCTCTCTCTCTCTCACGGAAACAA
CANNNNNNNNNNNNNNNNNNNNNGGGTCTCTTTTCTTTTTCCCCGAGAGGGGAATTGTATTAAAACCGAAATTAAGTTTTCTTTTTCCAAAAGCTAAATCAAATCACAGCGCCTCGAAAC
ATTGACGTAAGTATTGCTTGACCTGGAGCTTCACCGAGTTTCGGAGGAACTCCTCCGTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTATATAAGATGCTTAGGACAAGATAATTAGTTTAATTCTTAGTGTTGCATATTTAAAAACACAAGGAA
TATATTTTAATGTTTTCGTCAAACCTTTTGATCTTGGACCAATAGTTATTTCANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAGGTAAGTTTCCATGTGATGCCAATTTTATGGTGTCATGATATCGTATATAAGAGTGAGAACGTGACGTACCGGATCAAACCGTGCATTA
TAAAACAAGAAAATGAGCAGGTAGTAAATTGCATAATTCTCTTCATTAAGTGTTAACATAATTTAGCATTGAATTTTAACTGCCATCAGTATATGACTCATTAGTGAAATAGCTTTCATG
ATTGTTAAACTATAAAAATGTGTATTCTCATTGCATATATGGGTAAAGACACGGCTTGTATCAAATCACGTACATCACGACCGTTTGACAAATTATATTTAGTAGATATTTATATCAAAC
AGTGTTCTATGCTGGTTGTCACTTGTCAGTAAAAAGCTAGTTGTACTACTTCGGCACGGAAGAACAAGATGTATAATCACCAAACACAAAACACGTTAGATAACTTCTGCAATATATGAT
TAGGAGTGATTTGGGGAGCATAAAGCTTACGTTCATCCTCCAATCCAGTGCCACTTTTTGACTACGCATCGCACTAGCATTTTCTACATTATTTAATCATCAGAAGGATGCGGATCTTGC
CTTTAACGAAAATTTACAAAACCACACTAAGATTCCAGGCAACGTCGGGCCACAATGAACCCAAGAAGGGTAGTGACAGGAAAAGAAAAGGTCAGGTCGACTGTTCCCACCGCAAGCTCG
GTCTTCTACTGTTCATGGTCGCGTTTTGTGAATGCGATCAGGTGGCAGGAACAGAATTGAACTTGGAATTGTAGAACTGGAATTGGGTCAGGCTGGATGTGGCTGTTGGGACGCTCCTGG
AATCGGAATTGGAATTCAACCACGTTTCCGGCTGGATTGGGTTACACCTAGGAGATGGCCTCAACGATTCCGAGTTTCGGACCCATGGCCCTCTGATTTGGAACACCCGACTCAACGCAG
CCACCTTGCGAGTTCGTGAATCGTGACCAGTGTCGGACTTCGCCGTCGAACGCCACCGGCGCCGGACTCCGACACCGAGGGTAGGGACGAGCCTGCTCCTTACTCTACGTCGATAGGCTG
CTAGCATTTACGTCGGCAGGATCCTAAGTGAGTTGGGCTCTTGAGCTGCCTGCGAACTGCCTGTAGTTGATTAGAAAATTGCCTGATCAGGATCCAAAGGAGAAATGCAATTGAGCTCTT
GAGCACGGAAGACAAGCAGCACTGGAGTGGGGAAAGGACTTATAGACTTCTAGTTGCAAAGCTTCGCCATTTATGCCCAGGCAGGTGGAGCCAGCAGCCTGGCAGTCGATTTGCTCGGCC
TGGCGTCCGGCAGACAGCACGGGCGAGGCAAGTTCCAGGCAGTGCTCAGGACTGCGACCAGGCAGATTCCAGGCAGTGCCCTAGACCCAGGCAACATGTCCAGTGTTGGAGCGTCCCAGC
ATGTTCGTCGATCCTGTACACCCAGATGAACACCGAGCAGGCACACTGGTCGTTCACCGCGTCCCAGCACCGGTCATGGCGTGCCCTTATGTACAGGCTTCCGTGCAGGTGCTCACAATA
GAAAACAATTTCAAACATTTGCAGAGTTAAGGCTTTTCCAAGACTCGATTGAGATCCCATTTGCAAATACTAAAACAAGTTCAGCATCCTAATATCACTGAAGCAACTCCCAAACAACCA
GGAAACTGATTTTGTTATCAGCTGGAAAGCAAACTTTCCTCCACACACATGTATTTTGTTATCAGCTGGAAATGCTAGATTGAAGTTGCATAAAGAAACCAAAACATGCTGACTTACATA
ATTCTGCTTAATTTATAAGCGCATCCTACACTCTGGTTGCATGAAAACGTCTAGTTGTCCTTCGGTGGACGGCAAAATTAGAGCAACTGAGCATCAGCAGTTTAGCACCTCCGTGATTCA
TACTAGCTAACATTCTACTTGAGATTTTGGGACTTGTCCTCAATGGCTCACTTATGCGTCATTTTCTGTTTTTCTTCCATCGCCGTCGGCGCTCGCAATCTTGTCGTTCAAGAAGAACCA
GCAGACTGGCCCTCGTGCTGGACACGGTGCTCCGGCAGCCAACGGATGCAGAGTGGATGTTCTGGTGGCCATGTCGAACACCATAGGCTCAAACCTCGACTGCTCGTCGATCCAGTACAC
GCAGTTGGGCCTCACCCCTGACGCGTCCTCTGGTCGCAGCACCACAGGGTAGTTCTTGCCGACGAACACCGAGCAGCCTCCCAGGTCGCTCACCGCGTCCCAGCACGGCCGCCGCTTGGG
GTCGTACTTGAGGACGAAGACCTCGTCTTTCGCCATGCTGAACCTGCCACCTTCCGGCGTCATCGAAGAGACTGCGACGGTGGTGTTCCGCCACACTTGGTACAGGGTACCGCCGGAGAG
GAAGATATTCTTGGCGCCGGTGAGCTTGCACGCGGCGTCGTAGGGCGGGGCGAAGAGGCCGGCGCGCTGGGCCTCTGAGTGTAAGGGCGAGACCCTCGGCCTTCGCCGCCGGCAGCCGGG
GACGTGGAACACGTGCACGTCTCCATACCTGGTGACAGAGTAGACCTTNNNNNNNNNNNNNNNNNNNNNNNNNTCGTAGGCCAGGTCGACGAGCTGGTCGCGCTGCTCTGCCATGGAGAC
GTCCATGACCGTCCACTTCATGTCCCGTGCCTTGGCGTAGGCGAGCCTGCGCGGGCCGCAGATCGCCACGGCGGTGTAGTCGTCGGGCGCGGGGTTCGGCGCTAACACGACCTTGAGCAC
CGGCTGATCGTCGCCGTTCCTCAGCGGGAAGAGGTGGAACCGGGGGCTTCCCCGGCGAGAGGGTTCAGGAGGAAGACCCCCTGGGGTCGACGGCGATCCAGCCGTTGCTCGAGCCGACGA
GTTCGCCGCCAGTGGGAACCTCGGAGAGGTGGAACGAGCGGCCCGCCGTGAGGAACGAAGCGGACACGAGCTGGCCGGGCTGGACCTGGCGGTGGCGGGGAGCGTCGAAACCGGAAACGG
TGAGGAGCAAAGGGGTCGGTGGCGGGAGGGCGGAGCGCCACGCCGTGCAGACGCCGCGGACGCAGGAGTAGGACTCTAACGGGAGGCCGAAGCCATCGCTGCTGATGAAGCGGAGGAGAT
CCGGTGGAAGAGTCGCCCAAGGCCCGGACGACGCCATGGCGGCGGGCAACCAACAGATCGAGTTTTGGATACCTGGGAAAGGAAACTCGGGAACTTTTACAGTCCAATGTATATCTAGTC
TACTTTTGCACTTCGTATGCGTGTCAGTTTCTAGCACCTTTCAGAGTCCTTGACTCTCGTCCACTCGCATAAGAGTTCCTTGTCCAATTAACATGGTTATCAGGTTTGTTTGTTCTATGT
GTAAACGATTCTACGTTTTTTAGTTGCTCAGAAAAATAGCGTTCAAATGCATGATTTCAATTTTTAAGGGAAAGTCGCAAAAAAAGAGCACATGCATGCACAAGCACACACAATTTGATG
ACCTTTCAAATTCCCTTGGCAGCGTTGGCCTCTAATATGACTCTGTTGCTCCAGCATGAATCAGATGCCATTTATTACATATATATGGAGCATTGCAATTTCAGTCCAAGAGCAACAATT
TATACCAAAAAATGCCACACGCATGCACAATATCGTTGGACAAGATCAAGAAGAGTAAGATGATTTGTTACAATCGTGTGGTCGAGGAGAATTACATGATCGACCTAGAGCTACAGCCTA
CAGCGCTACACACTGAAGGCTTAACTGAAAACTACATGAATTTTCAAATGACTAAATAGTCCAAGCCATGTTGAGCAAAAAGGTTGTCTTCGCCCACCAAATCATATCAATCTTAATGCA
CCACTCATGTAGTTAATTTGGCCTATTTATATCTTTCTCCAGCATAGCCGAGCCAAACTTGGGACAAATAGCCCATTTGGCATGTATACTGGCAAATTTTGATCAGTTGTTTTGCTCAAT
CTTGTCATTTTGAGATACAAGAACTACAATTATGATGTGGCTAATTGTTGATTTCAGACGGAAATCTGCTCAGAACTCTTGGTTCAAGTTGTGAAAATAATGCAGAAACTATCAAGAAGC
TTAAAATGATAAATGATGAAGTAAAGGAAGGGCTAATTGCAGAACTGAAATATGTTAGCCTGCTCCTTGCAGCTTCTTGCGGCTAAGGCTCCCAGCCATTCGGCTGCCCCAAGTAGCATC
ATCTGCAGCCCAGCAGCTCGATGATTTGTGCACCACGGTGCCGTTCAAATAAGCAGTAGCTGGATGTAGCTGCTGTAGCAACTGTCTCCAGCACTACCGAGCAACATCTGTAAACTCTAG
CAAATGTCTGGTTGAAATAGTTTCTTTCGTGAGCTCTTTTACGGTACATAATACTAGACTATACTAATGTTCAAAAAGGGTTAATATAAAAATATAGTAGTATTACGTACCGTAAAAGAG
CTCTTCTTTCATTTGCTTCATTTGCTAGTTCAACCTTTCTTCTACTGGAATACAAGCTACGATTGAGGTATGTATGGTAGTAACAGTAGGGGCACCTGGTTTAACTAGTCATATCCTTTT
CTCAAAAATATGCCCCTACTGTTACTTGCGATGGTTGCAGATCAAGAACCACCGGTGGTGCTATGAAGTGCTAGTGAGCACATCCATCTAAGACATAAGGATTGATTCGCTTGCTGATCT
CCTTGCGATGTTTGTAATATTTCTAAAAAATTAGAAATATTAAATTGAGTGAAATTTCAAAAAAATAAACTTTTTGTTTGAATTGTGTGCTCATTTGAAAATGGAAGATAAATTCTTCTC
TCATCTAGAAATTCCCGAATAAATTAAATCTCAAATTAATTTCAAAACATGTGTGCTAGTTGATTTGGCTCTTTTTTATTTTATTTGGCTCTCAAATATGTGTGTGTTTGAATTTTGAAT
CTAATTTAAAATTCAAACTACAAAACAAAATCCAAACCTAAAACTAACCTAACATCTAACCCCAGTCCGGCCCGACGCCAAACTGGCCTGACCCGCCAGCCGCCCGCCTAGCCTCACCGC
CTGGGCCAGCAAGCCAGCCCGCTACGGTAGCCCAGCTAGCCCGCCAGCCTGCCAACACCACCGCTCCCCCTCTATTTCTCTCGCTGACGCGCTGGGTCCGTTCGTCAGCCGACACTACTC
CCCTTTCTTCCTCCTCGCGCCGTACGCCTCACGCACGCGGCGTGCGGGGGCGACGGGGCGAGCTCGCCACGCTAGCGCACACTACGTGGCTGCGTGCGCACCCTTGACTCCTTCCAGAGT
CTTCCGTCACGGGGAAAGCCTCGCTTTACCCTTGCCTCGTGCCTCCAAACCCTAGCGCCGAGCCGCTAGATGGCCGCCACGCCATGCCCCAGCGCGCCTGTCGAGGATCGACAGCGCGCA
GCCCTTGGCGCGCTGCCCCACTGTCTTAGCCCCGGCCAGCAGCCTCTCCTCGCCATTCCACACCACTCAGGGCTTTTCCCCTTTTCGCTGCCAGCCGATCGAGAGAAGAGGGAGAGAAGG
AGGAGAAGAGAAGGAGGGAGGAATAAGAAGGGCCGCTGCCGCCGGGGTGCTGCTCCGCCGAGGGAAGGAGCCGGAGCCGCTCGTCGCCACCATGCCGTCGAGGGGACTGCGAGCCGCCAT
CGTCACACCGAGGAGATCCGCGAGCTCGTCGCTGTCTTCATCAAGCAGTCTATTCTATATTTCTGTATTGGATTTGTACTATCTAAGATAAGAACTCGCACGTGATAGCCTTCCTAGGGT
TATCACGGAGGTGCGTAGACTTGAATTCTTAGAAATGGGAATTCGATCCGTTTTAGCTGGTATCATTGCCATACTTGATCGTAGGACGATCCCTAGCAATGAACGTTAGTCTAGGAAGCC
TAACTATCCTTGAACTGAGTACATATACTCCTTGACTGTTATACAACTCCTTGAACAATTATTATTATTACCTTGATTTCTCTAGCTTATCTGACTTACTAACAACCCTAACAATGTTTT
TCAGATGTCGACCGAGGAGTGGCACCCGTTCACCAGAGGGGTGTGCTTTGGAGGCTTTTGTGCTCTGCTTAATGATGGCCTAGAGAGAGCCAGAGTCTACACCCAGGACGTGTGCTACAA
GGGCCGCATGAAGGGCATCATGGAGACCATGCCCACCGAGGTGAAGTTGATTGTGCTCGCCGACCCCAAGGTACGAGAGTTTGACAAGGTCGCAATGCACGCGTTCGAGATATCCGTGAT
AGAGGCTCACCAGACCACCATCAGGAGAGCCATGCGTGAGGTGCACGCACAGCTCCATGAGAAATTGGTGAAGACCCCCTACCGTTGCCTACCCAGGGCCTGCCGCGGATCAAGGGATGT
CAAGAGTGCAGCCCGTCGGTACTACGAGAAAAACCCGATGAGAAGTTTTGTGTGGCCTCTCGCTGCATCCACGCTTACTCGCTTAGAACCGGGCACTATTCTAGATGGACAGTGAGGTTG
AGTTGCTTAGCAAGGGGTGAGACAACTGTATCGCTACCAATGCAGCTCTCGAGGGTAAGGTACTAGGGCTCAAGCGCAGTTTGACAGCCATGAACTAGAGGAACCGTTGCTTGCAGCGCG
AGGTGCACACTGCTCAAGTTACCCACTCAGAGAGAGACTCGCTAAGGATTGCCACTCTTGAGGCTCAAGTTGTTTGAAAGGAGGAGGAACTGAGGGACAAGGACAAGATCATTCAAGAGA
AGGACGCCCTGCTCAAGGAGAAGGAGGAACTGACAGATACCTTAGACTCATCTTTGATCGCCAAGGATGGGATCTTGGAGCAGCTACACTAACGCTTACACCACAACTACTACAACTTGG
TTCACCCTGGAGCACGTTGCTACCACAACAGAGACATGGCGAGAGGATTCAGCTGGCGTGGGAGCGCTCGGATCGCAGGAGGGTGATGGAGCTGGAGGAGCTGAGTGTGTGGGTTCCAAC
AGAGCATAGGAGGGAGCCCCGTTTGGAGAGCTTCGAGTTACCACCAACCAGACTGTACACTCAGGTGATGTCTCCACCCGTCAGAGTTGCTACTGAGGAGATGACCAAGGCACTGTCTAC
GCTCACCCAGCTGTACGGAGGATCACCACTTGAGCTGCCGGTGTACTCAGACGAAGAGTTGGGTCCATTCTATGCCCCTACCCCAGGGTACCGCCCAGGGGACATGGACAACAACGGCGA
CTTCTAGTACTCCGACTAAGTGGACCGCTTCTGATCTGAGTAGTGCTAGGTTTGAGCTAGACTCACCATGATGTAGTAGCATTAGAGACTACCACCCCATGATTATCGATGTAGTAGTAT
GATGTTGATCCTTATGTAATCGTGAAGGTTTCTGGAGTAGACCTCGAGATACACCTCTTTTGTATGGTGCCATTGCGTGAGTGATGTGGAGTTTCATGGTTTCAGTGGTTCTTATGCTTC
TTCTTGCTTGTGTGAAATTGTTTGCATGTTTTAGCTAGATACTCTTTTAATAATTAAATAACCCTGTCTAATCTCTTAAGAATACCCGCTGATCCACGATCTCATTTGGAACAAATATCG
GGTATGAGGAGGTTGGGACGATTGCTGCACCGTTTCGAGGAGGCGGCCAAAGAAGACGGGCCTAACCCCGGCAGAGGTCGTGGTTGTCGCGAAGGTCGTGCTCCCCGAGGTGGACGACAT
GGAGGCCGCCGCGAAGGGCGAGGAGACCATGTCCTAGGGATGGATGACCAGGGAGACCAAGCTAACATAGAAGGGGAGGTCCACTAAGAGAACCAGGAGGAGTAGGAGCAGGACCTAAAC
GCTGGAGGGGCAGAGGACCAGTAGGCTCTGCCGTCACCCAACCTTGCAGAGGTGATGGCCATCCAGACTTAGCTGATACGTACTATAGCCAACACGTTGCTCCAATACAACCAGCAATGA
GGACCCCGTAGGAACCCCCCAGTTGAGTCCTTGCAGAAGAAGGTATAAGGTTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAATGCATTAGTTTCGCAAAGGACTCCACAGAGGCATGGAGATGCAC
TTGTCTGCCTACGACTGTCCTACCCTACACGCTCTAGTTGGCAAGGCACTTTGAGTTGAGAAGTGAAGACTTGAGTACGAGGAGGTACGAGGTAACAAGAGGAAGTGCTAGGACCAGTCT
AGACGCTCAGGGCTGTGTCAAAGGCCGAGGATAGGACCCCCATAGTTCCAGCAGCAAAAAACCCGCAACTACCCTACTCAACCATAGAAGTACAGGAACATCGGAGGAGGAAGTGAAAGT
TCCGGCACTTGGAAACAGAGGCCTCAGCAGTCTACCGCTCTTGAGGGCATGAAGTCAGTTGTCTGCTACTCGTGCTGCCAGCCCATGCACAAGTCATTCGAGTGTTCGCAGAAGACTCAG
GCTGGAGGGCAGAACCGCACCAACCAGTACCAGACACCAGCTAAGTCACCAGCACTCGGAGGACTGTGGCAGAGGAACCCGGCAAGAACTGCACCGCCATCTACTCGAGGGCGCCTGAAC
CACCTGACGGACGAGGATGTTGCAACAACCCCAAACGTCACCCTCGGTGAGTTCCTTGTTGACTCAATCAAAGCTATCGTTTTGTTCGATACTGGTGCCAAGTTTTCGTATGTTTCAACC
AAGTTTGTGAAAGAACGGTCTCTTCCTACTATGCCTCGACCAAGACCTATTATAACTAACTCTCCCTTGGGAGAAGTGAGGAGCACCCTAGAGTGCAAGGCAGTTCTGTTGANNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTAGACATCTAAATTGGTTGGGCGAAACTAGCCCCTGAACCACCCTAAGCCCCTTGACT
CAAAGCATGCCCTTTTAACGCGAGCAGCTAGGGATCCACATCCCCTTTCATGGGTGCTATCGTGTGGGTTCCCCATGCCCTTAATTGTCTTGATGTGACGCCAAGCCATGGGGGCTCGCC
ATGCGGTAGGGAATCCTGGTTCACAGTTCCCACGCCCATGACCAAGTCCCGCTTCGAGACCCGAGAATGGGCCCCATATCTTAACTAGACGACGGGGGGAGGGGGGCGGGGAGAGGCGTC
TCGTCTAGCCTTGGCGCCCCATCCGCTTTCATCCCTAATAACATTATATCTACTTTTGAATTGAAGTGTCTGACTCAGTATCCATTAGAATTGTACCCATGCCAATTTTCTTAAAGTATA
TCTAGTACCCACTTGAATCGTGTCCACGCCAATTTCCTTAAAGTATATCGTAAGAGGCACTTATCTCACAGACTTAATGGTTGTTAATGTCAGTAGGTATTGCTAGTTAGATATTCAGAA
TTGATTATTCCAGGTGAAACAGATATACACTCTTTATTTTGTAAACATAAACTTTATAGAACTTGCCATTTACTAATGCTTGTTTTCAAGGGAGAATGGATAATTGTACTAGTAAGGTAG
TAGCCGAAACTCTCCTCCAAACTCCACCATGAACAACTACCGCAGATATGCATAAGCATAAACTGGCACACATGATGGCTTAAGTTGTAGTAGCATATATACATCAGATTCTGCAATTAC
CCCATAAAACTCTTCTAGTAGCACTGTGACTTGTTTATTGAAGATCAAATGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTAGCCAGCTAATCATCTTTACCAAAATTTACATGTTCCCCATCAGCTATCACACTTTTCGCTTATTATTTTTGAAGTAGT
CGACATTATTAAATTTATACCAAATGACTCAAGATTGCATGTTATTAAACAAAGTATGTACCCGAACTAAAGATATGGCAATTTGTCAGAATTATAGAGAAATAACTAAATATGTANNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNTACCACCTTCTCCACCCTGGTACTAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTAATGTGCTTCTTGACTCTTCGAGACTTG
CACACAATCCTCTCCACCCATACTTCGTTTTCTTCCATTGTTCTCGACGCTCATAATTTTGTCATTCAAGAAGTACCAGCAGACTGGTCTGCACGAGGGATTCAGTGCTTTGTCGGCGGA
GGGATGAAGAGTTGAGATTCCAGTGGCAATATCGAACACCATCGGCTTGTTCCTCGACCCCTCATTGATCCAGTAAACGCAGTTGGCCCTGACCCCTGGCGCATCCTCTGGTCGCAGCAC
CACAGGTTGGTTCTTGCCGACGAACACCGAGTACCCTCCCAAGTCCTTCACCGCATCCCAGCACGGTCGGCGCTCGGGGTCGTACTTGAGGACGAAGATCTCGCTTTTCGCCATGCGGAA
CTGGCCACCGCCCGGTATGTCCCAAGAGACGGCGCTGTTGGTGTTCCGCCACACTTGGTACAGGTTACCACCGAAGAAGAAGACATTCTTGGCGGCTGTGAACTTGGACACGGTGTCGTA
GGGCGGGGCGTAGTCTGCGGCGGGGTTGTACGGCAGGCCTGCGCGCTCGGCGGCCTGCAAAGGGTTCAACGATGGGCCTCCGTCGCTGGCGCCGGGGGATGTGGAGCACGTGCACGTCTC
CCAGCACGTTGACGCAGTAGACCTTGCCGGCGTCAGAGTCGTAGGCCAGGTCTACGAACCAGTCTCTCGCCCCGATGGCGACGTCTAGGATCATCCACTTCATGTCCCGCGTCTTGGTGT
AGGCGAGCCTGAGCAGGTCGCAGATCGCCACCGCGACGTAGTCGTTTGGCGTGGGCTTCGGCGCGAACACGATCTTGGGCACCAGCTTGCCGTCGTTGTTCAGCTGGAGGAGAGGGACTT
TCTTGTCCTCGCCGGCGATGAGGTAGATCCCCTGATAGGGGCAGCCGTCGACGGCCAGCCAGCCGTTGCTCGAGCCGACGACGCAGCGGCCTCTCCAGCGAAGCGTGGTGAGGGGGTACG
AGCGCTCCGCCGGCAGGAACAGGGCGGACACGCGCGGACGAAAATCTTGGCGATAGTAATGAGGATCGTGTGCCGGAATGGAGACGGTGACGAGGGAAGGGATTGGCGGCGCGCCACGCG
GTGCAGACGCCACGGGCGCGGCTGTAGGATTCTAGGAGGCCGAAGCCATCGCTGATGATGATGAGGAGCTACGAGGGGATGCCCGCCCAAGGCCCAAACGGTGCCATGGCGACCTTGGCG
GACTTCTGAAGATGGCAGTATGACAATCTGACGAACTAGGTTAGGGTTTATGGGAGATTGAGGGATTTTTATGCTCCAAAGTTTATCCGGCGGCTTCTGACTCGTGGGCTGCTCAGTACC
GTGGACTGTCAGGAGAGGAAGTGCGCTGGAGAACCAGCCCGCCACACGGCCCAGTAAAAAAGCCACTTGTCACTTGTGTTGCTACTCTATTTCAATACTAATTTATATTGTTCAAGTTCG
TTTAAGCCCTATCTCGAGATTTGTTTAGAGGCCACGGAAGTCCAACGTGAGTTGATTCCTGGCGATGACAACTACTCCATCCAACAACAAATATTTGACATCTGGAACAAGATTCTATAC
TTTGCAACTTGGATATCAGTTCCTTTTAAAATAGTCTACCTGATTGCAAATACAGGCAACTTTGGAGCTAGGCATGAAGATTAGGAAGATAAACAGGCTCGGCACCATTTAATCCATAAT
CATGGGCGACTCATGTAAAGGTGATCACCTTGAATTCATAAGCGACTTATATTTAGAGAATAATATGGAAGGTGCGGCATTTAGTTCGAAAATGAGAATAATATATGTAAATCTATCATG
AAAAATACTTTCACAATCTTATAGATGTATTCTGATAAAAAATAGCAGTCAAATTCGTATATAGATGATAGTGAAAGGTAACACAAATGTCAAGTACGCCTGAGATAAAGAGAGCAATTG
TTTTGCTTTTGTTTCGAACCCTGTCGATGCAGCTTGATCAATAGATATGAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTAACAGT
TTATGCAACGTAACCATCTGATTAATCACTGCTTAGCAATATAATATGTTGAGTTGAAGATATAAAGCCAAAAAAATTTAGTAAATCCTCTAAAGTGGTACCCATAATAATTTTATTAGA
AAACTTATCAGAGCTGATTCACACCGAACTATTACCGAGACTGACTCAACATTGGACATGGCTAAACAATGATTAATAAGATTATTACATTGCCTAAACTGATGTTATATGACCCCNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNATTGCAATTGATGATTCATCGAGGTAGGGGCGGTGGACGGCGCCTACCTGCTGCGCAAGAGCATGAGGAAGCCCGAGAATTTCAGGGACTTGGTACACCTCCGTG
CACGTACCAACACGTTAGGAAATCGTTCGCTTTCTGTATTACTTTCTTTGCTCAATTTGTCCTGACAGCCTTGAACTTGTACTCGGAGAACGCCAACTAGAGCTTTGCTGTGAAATTGTG
ATCTTACAGTGGGAAATAGAGTTTCTGAACTTCGTACAGTATGAACTTCTTGGTGCATAGATCGAGTTGTAGAAGTAAATTACTGTTTCTTTTATTAGTAACCTATATTGCAGTATCTCT
TTCAAAATGAGAACAATTCATGACGGTTGCAAACTTGCAATTCGAATTAACATTTTGCAGATAAGCGCGGTTGCTCGGATAAGGCATCGACTGGCCTGTTCAACGCACAAATTTTTCGAC
AAGAATGGTTTTCTGTATGTCCACACACCCATAATTACCACAAGTGATTGTGAGGGTGCTGGCGAGATGTTTCAGGTCACAACGCTATTCAGCCAGGGTGGTGGAACTGTTCCATACAAG
GATGATGGAACGATTGTCTGCCGGCAGTATATTCATTATTGGATATGTTTAGCACTTTAGCTTGTCTTACTGTTTCCTGAGTTTTAAAATTTTTTCTCCACTCTGTTCAGCTTGTGGCTC
TGCAACCTTAGAACAAGACGCTGGATGTGCTCTCCCTTAAAAAAAAAGGGCACCGGATAAGCTCACAGTCACAGCATTGGCTCTCCTGCCCTTTTTCCTCAAAGCCTGTCAGGAGTCCAT
TAGTGTTTCCTACTTGTGTTTAATTGGGCTGTAAGGGCTGCTGATCCTAGCTAATAAGCTTGATGACAGCATTTTTTTGAGGTTTAATCTCGTCACTTCAACTATTGATCAAATGCTCTT
TTCTTTTTCACGAATGTGGCAGGAGAGCAAAGGGTCCAAGGGCGCGTGCATAAGATTTCAGAACAGATGTTGTCATGTTGACACTACTGTGTTTTTCGATGTTAACACTACTGTAAATGT
TTCCCTATTATTGTTGTATAAATTCTGCAGACTAACATTACTAGCTTAGCACCTTTTTGCTGATCAGCAAATTTCCTTTCAGGCTTAAATCCCTGAATGCTCTCAACATGGTACATGCCT
CTTCGAAAGGCCGAAATTCGCGTGGAAACCGCTGCCTGAGCACTGGAAACCGCGCACTGGAAATCCTAGTAACAGAAAACTCCGCCGCGCATCTTTCGGGCCCCTGTCAGAGACAAAGGC
AAACCTGTCCCACCCACCCCGCGACCGCGCGCGCGGGAACCCCGCGAGTCCGGCGGGCCGCCAACCGCCGTGGTGGCTGGCACGCGGTACCCGTTTACCACGCGTCGTCTGCAAGCGTCA
CGCGACGCCCCCACCCACTGCCTGCCTCGCTCACTCACTCACTCACACCGGGTGGCCTGCGCTGCGCAGGCCGGACGGCGACGACGGCCGCGTCATCGGCCCGGGGCAGGTGGACCATTT
CGCGAAGGCAACGCAACCCGGAGGGGCTCGCCCGTAAAATCACACCCCCATCCGGAGGAAGAGAATGGATCATAAAATTCCCCACCACCCCCACCGGGGGGATCGNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNAAACCCTAGCGGCCCGAATCCGGCCGCCCCCATGGCGCCGTTCCGGCGCTGGGCGGACCTGCCGCCGGATCTCCTCTGCCGCATCGGCGACCGCCTCGACCTCAA
GTGGTACGCCAGCGCGCGGGGCGCCTGCACGGCCTGGCGCTGCGCGCTCGCCCCGCCCTCCCCGGCGCTCCTCGTCGTCGCCGACGACGCACGCTGGTGCCCGCACGCCGCATCCCTCCC
CACCCGGCGGTCCTTCGAGCTCACCGCCATCGTCTCGGGGAGCCGCTGCGTCGGCTCCAGCAACGGCTGGCTCGCGCTCTCCGTTGCGCTCTTCACAGGCCAGACCGCCTTCGTCCTCCT
CAACCCCATCGCCGCCGTCGAGATCCTGCTCCCGCCCCTGATCTACGAGAGCCGATGGGTCTCCAAGGTCGTCTTCACCCCGAGCCCCGCCAAGGACGACTTCGCCGCCGCCGCCATCTG
CGACATCGACAGGATCGCCTACGTCACCGCGGGGGCCAGGAGGTGGGCCGTCCTGGAGCCCGTCCGCCTCACCAGCGGGGACCAGCTCACGGATGTCGTGTACACGGACAAAGGTAAGGT
CTACTGCCTCACCAAGTGCGGGGATGTCCACGTGCTCCGCCTCCCCGAGCGCCGCCGCCGCAAGCCCGCCAACGCCGACGAGGCGGGACCCTCGGAGCCGGAGTTCTCCGTGCTCCAGCC
GCCCGCCGAGCGCTCCATTAATTTCCGCCCGATGCGGTGGCAGCAGCAGCGCAATTTTCGCTTGGTGCGCTATGAGCAGGCGCGGACAGGAAATCTGGAACCCATTCCCTTGAGGCTGAC
GCTCTGCGCGGAGTCGTTCTCGTACAAGAGAGTTCCACCTGAATCTCAAGGGCCGGACCTCAACGCGCCAGCCACGGTTGAGCCCCTCCTGTCCGAGGCCAACCTCCCGTTCAACCCTGC
CACTGTCTTTGCGCCGCCCTATGACACTGTGTCCGCGTTCACTAGTGCCAAGAACTTGGTGTTCTGTGAGGGTAATCTGTACCAAGTCTGGAGGAACGCGAGCTGCACCGTTACTCTGCA
GCTGCCCGCAGGCGGTCAGCGCCGCGTCGCAGAAAATGAGATATTGGTTCTGAGGTACTATCCCCGGCGCCAGCCTTGCTGGGATGTGGTGAAGGACTTGGGAGGCTACTCGCTCTTTGT
GGGAAGGAACAATGCAGTGTCCATGTATGCAGAGGGCGTGCCAGGACTAAAAGGCAACTGTGTGTACTGGATCGGTGGGCGTGGCAGGGATCAGGGAATGGTCTTTGACATGGAATCTGG
GAGGTCCACGCCATGCCGGGCTCCTCAGGTTGGCATTTTACCTGGGCATCCTCATAGCACGATCTGCTGGTACTTCTTGAGCGATTTAGTGAGCAACAACAGCAACTGCATCACCACCAC
CACCACCGTTGCCAGCAGTAGCAGCAATGGAGGAAGAAAAGTTTATCAGACCCGAGCAAGAGCCCGGGCCGATCTTGCACAGGACGTGGAAGAATGATGCGTCGCCATACTGATTGGCGA
CATAGTGAGCACCACCAAGCACCTTGGTGGAAGTTGAGTTCATCACCAGGCTTTGCAAACCGCTTGCGGTCTTTGAGAGGCAGAGCTCCATCTCAACGTGAAGCAAAATCTTGCAGAGAA
GCGACGAGGAACCGCTTCATGTGTAGCTGATAGTAGATTTCAATTCCTGTTTCCTATAATAATTTTCAGTCTGTTTGCCTGTCTGTAGCCTCTGCAATATTTGTATGTTCATGTCATGTA
ACCGAATAATTACCTTCTTCTTTGTATGCTTAATTTTCATGAAGTTGTGTTAAAATAATTCAATGGATTATGTAGTAGTTCTGAATTGTAGTATCAGCTTCCGTAATGCCTGCTGTTACC
TTCCTAGTCTAAATCTGTGTTAGGTTACAGAACAAGCTTGGTGATCGCTGATCCCTTATTTCTCTTTATTCTGTTTCCACACACTCGCATCCTCCTAGTGCCATGCTATATACAAAATTA
CAAATACAACAAGCAAGGGCTATGCAGTGATGCATACTCTCTGAACTCTCTCTGGGCTTACCATGGGCAGAAGCAGACGACCTCAACGCGCTTCTCCATTCAGGGCTCCAAAGCGATTTC
AGTGGGCAGCGGCGTCTGCGGATGAACGCTGAAACACAGCGGCTGGAGCGACCGGACGACCTCATCCATGGCCGGTCTCTGGTCGGGCATCACCGACGTGCAGCGCAGAGCGAGCTCGAG
GGCGGCCTGCATCCCCTGCCGCGCCGCGCGGGAGATGCTGGGGTCAAGTATCTCCGAGTCGGCCACGTTGATCCGCCGCCGCACCCACCTGACGATGTCGACGGAGTCGTCGTGGGACGC
CGGCTGCTCCGCGGGCTTCCCGGTGACCAGCTCCAGGAGGATGACCCCGAAGCTGTACACGTCCATGAGGTGCGTTGGATTCTTGGCGCAGCTTTGCTCTGGTTTCAGAAAAAATAAAAA
GAGGCAAAACGGCGTCAGTGAAATACTGAAATCTATTACCACCAGTTCTCTTTCGTACTGACATTGCCCGGTATCCGAACTACACACATGCATAGAATCTGGGTGGATTCACCGAACTGC
AAAAATGCTTACCTGGTGCCATATAGCACTTGTAGTTCAGATCCGAAGCCATGGAAGTCTGGTACGCCATTTCCCCGACAACACGATCGATCCCAAATCCTGCAATCCTCGGCTCAAATT
CGTCACCAAGAAGCACATTGCTCGCCTTCAGGTCTCTATGCAGAACCTGGGGAGTATGGTCATGGTGAAGGTGGGCCAACCCCTGGGCTACACCCATGGCGATCCTCACCCTGTCCTTCC
ACCCCACCGTGAATTTCGGCCCGCAGATCAGATCCTGCAAGCTTCCCGTCTGCAGGTAGTCGTATATGATGCTGACCTCCCCCTCGGAGTAGAAAAATCCAAGCATCTTGGCGATGTTCT
TGTGCCTGACCTTCGCCAGCGCCTTCATCTCGTTCTTCACCGCTCTGAACTTCAGCTTCCCTGAGTTCACCAGCCTCTTCACCGCGATGTTCTGCCCGTCTTGGAGCTCGATCAGGTAAA
CCTTCCCGAACGCGCCCCTGCCGATGATGCTCCTGTCGTGGAACCCGGCGAGCAGCTCCTCTCCGGTGATCTTGACGGGGTGGAACAGCACGAGCTTCCACGGTGAGGGCTCGCCGCCGT
GCAACCTCCTGCAAACGGCGAGTGCTCCTACGGCGAGCAGCGCCACGCCGGTGAGGAACGACGCCACGGTTGCGGCCAGCGCTAGTCCCCGATGCTTCGTCGATGGCGCGTCGTCGCAAT
CGTTCGGCAATCCGGGGCCACAGAGGCCGGGATTGCCTTGGAGGAACACGGCTGGGAGCTCGGAGATCAGAGACGGCGGCACGCGGCCGGAGAGCCGGTTGTACGAGACGTTCAGCAGCG
CGAGCTTCAGGTTCTGGAGCTCCGCCGGGACGCCGCCGGTGAGGCCGTTGCTGGACAGGTCGATGTACGTCAGCACCGGCAGGTCCCCAAGCGACGCCGGTATCGGCCCGGTGAGGCCGT
TCCCGGCGAGGCACAGCGACACCAGCCTCTTGCAGTTCCTGAGCTCCGGGATCGTGCCGGAGAGCGCGTTGCGGGAGATGTTGACGATGCTCATCGCCGGGGAGTCGCAGACGTTGTCCG
GCAAGCTGCCGTTGAGCCCGTTCAGGGAGGCGGAGAACCGGTACAGGGTGCGGACCAGGCCGATGCTCCCAGGTATCACGCCGGAGAAGCTGTTGTTGTCGAGCTGGACCTGCTCGAGCC
GAGACTGGCCGCCGGAGAACTCCGGCAACCGGCCGGTGAACCGGTTGTTCTGGGCCCGGATCACGCGCAGGTCCGGCAGTGACCAGAGCCCGGCGGGGAGCTCGCCAGTGAAGGCGTTGT
CGTGCACCTCGAACCTCTGGAGCATCAAACACTTACCAATCTCCTCCGGGAACGGTCCGGAGAGGCCGTTCTGCGACAAATCCAGGGTCATGAGCTTCTGAAACCTGACGCTGAATCGGG
GTGGCACGGCTCCCGTCAGGCTGTTCATGGACAGGTCAAGAACCTGCAGCTGCTCCAGGCCGAGGAAGGATTCGGGGATCGCGCCGGCGAACCCCGACCCCTGCAGGAACAGCCACCGGA
GGCTGCTCATCTCGCCGATCTCCGGCGGCAGCTCGGACTCCGTGAACTGGTTCCCGGACAGGTCGAGGAGGTGCAGGCCGGTGAGGTTGCGGAGCAGCGCCGGGTGGAGCACGCCGGAGA
GCCGGTTGCCGCCGAGGTTCAGCACCTCGAGCCGGCTCCCCAGCGCGGCGAGGCCGGTGGGCACCTGACCCTCGATGCTGTTGCCGCTGAGGTCGAGCGACACGAGCGCGGGGAGCGCGG
CGAGCTGCTCGGGGAGAGGGCCCCAGAAGCCGGCGGAGCTGAGGTTCAGGGACGCGAGCGAGGCGCACCGCGACAGGTCCAGCGGGACGGTCTGGTTGAAGGCGTTGGACGCGAGGCTGA
GCGCGGCGAGGCCAGGGACGCGGCAGAGCGAGGCGGCCGAGAGCTCGCCCGAGAGGCCCAGCCCCTGGAGGGCGAGGGAGACGGAGACGGTGGCGTTGGCGGCGGCCGTGGCGCTGGTGC
AGGAGACGTGCGACCAGTTGCAGTAGGGTGCCGAGCGCGACCAGGACGAGAGCGCGCCCGACGGGTCCTGCAGGGACGCCTTGAAGTCGAGCAGGAGGTCCTGCGGCGTCTGCGCGGCCG
CCGCCGAAGACGGCGGGGTTGAGGCGGCGATCAATGTCGAAACGAGGAGGAAGAGAGGGAAGCTGGTGGCGGCGGCGGCGGATCCCATGGACGACGGAGCTGGTGAGTGGTGGTGCACGG
AGAGGCGGAGTTGCGGATGGACTAGTGGAGTGGCAACTACAGAGTGTGCACGCTGCCCTCTGTTTGGTATCACTCGCTGCAGGACTGATCGTGTCGTCGGACAGGGCGTGACTACTGTGT
CGTGTCATGGATCATTCACTCGCTCATCGCCAGCGGCTCGTCTAATCCTCTGCAAAAAGGATGAGCACGTCCGGTCATTATACTATAGGCTTATCTAGGTGATTAGGTAGTGGTGGTGTT
TGTAACATATCACCTGCAGGGATGGCAGTACATTCTTGCCGGCCGAGTCATGGCACCGGACGGCCTCGCCTTTTGCATTATTTCGTTTGGACTTTGGGATGGTGACGCACTGGCAGTGGC
ACTTTTGGACTTGGAGTGGCGCCCTTGTCCTGCTCGTTGGACGCGATGTGACGTTCAGGTAGTACTGGCCACTGGGACCGGCCACCATGGCATTGGCAATGGCATGGCCATGGGCTGGGT
CTACTACTGGTGGCTGCAGCAGCAGCTCTAAGTTCGGCAGAAGGCGAGAGAGATGTCAATGGCGCCAAAACCTTTGACTGGATAGCAGTAGTTCGTTTNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNCGCCTGGGTAGGTTAGGTGTGACTAGTGAGCTGACTGATCATTGATACTCGCTACTATTATTCCCTGCTACTATCATCTAAGNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCAACGAACCAAACCAGGCCTAAGAACCCTACCTCCACCCCCAACCTTTTGCCGTTAGGGTG
AAAAGGATCCGATTTAGAGGCAAAACCGGGTAGCTTTCCTAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNTAAGCAAAGGTACTGTCAGTTAAACCAAGTTGCCTCCAATAATGGATTTGAATTAGTGATGAAAAAAGGCCAAGTACAATCAGTAAACCAGC
TGCCCTGATATTTTAATCCTCAGCGGCGCGCGTCACGGGCGCTGCACCACCTACGGATACAAACAAAACAAGTAAAGAAACAGGGGAGGGCAGCAGAGTACACAACAAAATCTGCCGGCA
GATATGAGCAGCTTGAGGGGCTAACTAGTAAAGATGAGGGTTACGACAGAGGTGGTTGTCCTTGTCTTCCGATCACCTGACTTTGATGACTCGGTGGTCAATATGAACAGTCCTTGGATT
TCAGCAACCCGTGAGTTTCGCTGATTCCAAGATAAAATGCACTCTTCTCTGACAAAAACAGGTACAGCCACCCAGATTTCACAGGTGTTGCACTCTTTTCTGACAAAAATGACAAACTAG
GAAAGACAACGTTGTAGAAACACGTACAGGCCTGTACAATTAATGGCAGCCAGATCTCAGAGGTAGTAGTGCGGTACTATTATGTTTTGTATATTTACAAAACTGGCCCAAGAGAGTGAA
AGGAAAATATACCCTCCAGTAGAAATAAGATGAATCTCGTTACTGAAACTACAGGTTTGGACATGATCACCATTCGATACGGATACCGTGGAGGCCGAATAATCTATCAATAATAATAAA
AGTTCCAGCGTTCCCATCGCTTTCATCTCTTCCTCGACTATTTTTTATATATATTCTACTCTCCAGAAACTCCACACAGCCAGCCAGCACAGCATGTGTGCCGATGGGAAAAAGGCACAA
AAGCCTCTCACAGAGTATGGCTCAAAGTTTGACGTCCACAAAAAAACAGCCTCCTACAAACTAAGATCTGCAGCTATTTAAATATGTACCAAAAGTGGCCGAATGAAGCACGAAACAGCC
ATCAATCACGAGCTCTTTCTGCGAGATTTCATCAGGATCAGTGGCATGCTGCGCCTGGCCAGTCATGCCATCGCACCATCATTTGATTTCGGCTCAGTGCGTGTGTAGGTGAAGCTTCTT
GTGATTGGGGTGACCAACTGATTCCCAGGAGCTGCAGGTGCAGTTTGACTAGGTTTTCCGGCATCGGTGGAATCAGCAGCGCCACGCTTCCACTGGAAACTCCGGGCACCACCTCTGAGT
GGCAGTCGCCCGCGGATAGCACCAGGAAAGGTCGGCCTTGGGTATGCAGTTCTAATGAGCCTTGAAGCGAAGGGTGACCCCCGAGAAGCGCGGGGCAAGCCAGACAGCTGGGTTGCTTCA
GTGGAGCTTTTTCGAACGACCTGCAGCACAATATGATTTGAGTTACTTCTAAGATCTTGCTGCTGGGAATAGTTTCACCAGAACACTAAAAAGCACAATCAACTAAAAACAACCTGAGTA
TAATTTGTCGCCATAATTTACCAATACGGAAAATGCTAATAAAGCTACTGACAAAAGTAATGCACATTTTGTGCAACCCTTAGCTCAGAACAGAATGTATATACGCGAGCGTCGGAGAAT
TACTTAGCAAATCTTACTAAAGTAGCTAGGTCATGTGTACCATATAGGGCCTGTTTGGATGTGCTATTGCTAAAGTTTAGCTCATCTAAAGTTTAGCACTTCCACCCATTAGCACTCCCG
TTTGAAGACATGGCTAATGGATAAGCTAAAGTCCATGAAAAGTCAGTTTTGCCCTTTTATCTCCTCACCTCCTCCCTTTCTCTCTCCCTCTTTTGGTCTTTTCACAAGCCATTAGCACCC
ATTAGCTCCTCCCCACCAGCTAATGCTTTTGCACCTTTTTGGGGTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNACT
TTCACCCATTAGCCATGGGATCCAAACAGGCCCATAGTCTACTAGAAAAACCATGCTGTACAATTAAACATTCAGTTAGGTTGAGGTATTTACCTTCAAAATGCGTGACATAAAAGATGT
GCCGTTCAGGGTTAATGCCTGCTCTGCCGATTCTTTATGCAAGAACTCAATATACGCTGAGCTGATAAGTCAGAAGGAGAAAAAAATGAGGATACCGACTAATAAAGCTGCTTTTTTCAG
AATTGCATATAGAAATAGAATTCATACCCTGTTGGCTGGCCAGTGATGCCATCAGACACAAGAAGGGTCTTTAGGACAGCCCCAAACTTATTGAAGTGACGAGTAAGAGCATCTTTTGAT
GCACCAAAATGTACCTAAAATGAAACAAAACAAGTAAACAACTAGTAAAGAATGAAGTCTTCAGCTACATGAACATAATGGAATAAGCAAAGGACCACATACATTGTTAACAAAGACAGT
TCTAGAATCAGGGCCACCTTCAGGTTGACCTGTAGTATTTGATCCAGCAGCTGGAGGAAAAGAACAGAAACTTTAATCATCAAGGGAAATTAGAAAAAGAAGAAATAATACGAAAAATAT
ATTCACAAATATAAGCACTTTAGGCCATCCACACGGTACTAATTTCAATAAAAACATATTGTTTCAAAAAGAAAAGGTTTTATGTTACAAAATTGCTGTTCGTGATTAATCTAGTAGCCT
CAAGCTTAGATTGCAAAACTATTTGGATGGTTAGCTATTGANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTAGCAATT
TAACATGGTTAAAAAAATAAATATCAATGGGAGAACAAAAGGTTCATATTAAGTGATGGTACAACAAAGATCTTTTAAAGAAAAATGTATTCTGAGGGCTCATATCAAAGCTTAATACAT
CAGAAAATTAACATGTCAAATCTCTTGCAAATTTTGTTATAATCTAGCATTAAAAAATTGTTTATGGAAAGCATGTCCCTATCAATAAATTGCAGGTAAGTTCAGAGGCAAGAACTATAA
GCCAATCAAATAGTAGTACCAATGACATCATAACTTGTAGCTAGCCTTTCCAAATCCCTACTGGAACAGTATTTTTTTAACTTGATATCAAGCACTACAGGAAACACCAATTAAAGCACA
TCTCTAATAGGATAAAAAGAATGCTTCCACATAAACACTCCCCAAAGTTACCAATTAAAGCAGTTGTCGCTTCCAAAAAAAAAAAGAGCAGCTTTACATACCAAGTGACGAAGCCTTTTG
CGCCTCCAGCATAGAACCTGAATGTATAAAATCCTGGAATGTATTTTTAACAAATTAGAATAGAATGACACACCACAAATGATCCAGAAAATACAATGCTTCATGAATCATCACAAAAGA
AATATAGGCAGTAAACATGAAAAAATATGAGTAAACAATTAGTTGAAAATCTGATATATTCCTTGCCAATGCCACGTGTAGTCCAAAAAACATGAGTATCAAATGGCGTGGCATGGTTTG
TCTAAAGGATATGCAGTAGCATCCTGGTCTGAATGCTTTGACTTGAAACATTAAATTTAGGGAAGACTATACCACTAAACCTCTAAGCACGGAACATGCAAGGAACTCGAATGTTTGTTA
ATTCTACACTTAATCACATATACAATTTAAGGGGGGAAAATAAGCCACGGGAAAAGACAGATAAAAACTTACTTTGGACTTATCAGTCATGACCGTATCATTAACATGCGTAATTTTCAC
ATTTGAGTTCCTTGCATCAGCAACCTTCTTCTCCATTGGCACTTGAGGGTCAGATACAACAGCATCCCTAGTTTGATGAGTTGGAAGTTTCCGCATACTAGTGTTAGCAGACATATTTAA
GTTCTTTCCGGATGGACTTGGTCCTGAACCAGCATGTGTGCCCTGAGCTATCAATCTTCTGCCTCTTACTTCAACAGCTCCCCTTACATACCCTAATACTAATGACTCTTTGCCTGCACT
AGAAGACAATCTACTTTGGCGAGAACCCAATCCATTATACCTTTCATACTCATCAATATTGGGAGCAGAACCTGTAGCTTCCTCTGATTCCTGGTCATGCATGTAAGCATCACTGCCACC
ATACTGATTTCTTTCATAAAATTCAACTTGATTTTCTGCTCGTATGTTATCTATATTCTCATATTCTTCACCTTCTGGGTCTTGTTCTCTAAGAGCATCAGTATGATTTATTGTGGGCAT
CCTTCCCAATCTATTAAAAACACTCCCCGAAAAGCTACCTTTGATAGCATCTTCAGCCGCCTCAGCTGCAGCTCTTAATGCTGGTATTCTCACATCTGAATTTGTTTTCTGCAACCTAAT
ATGAGTAATATCAAGTGCCGAATCTGACGCCAATGTAGACACCACAGAACGAAGTCGCTTGGAAGCTGATTCTGATCTAGGAGTCACTGGCTGCACAGTTCTGACAGCATCGCGGACAGC
AAACTGGAGAAGTCGGCGTGGTGCGTCAATAACTGGGTTGGATACCCTCTGGAAATATGTTAAGAGTATTATCACAAAGAAGATATAAAGGGCTACTTCCACTGAGAGAGCTTACAGCAA
TTCATAAATCATATCAGTAATGGTATAATAAACAAGATAAAGCACAACAACATATTTTTGATCATTCCAGAGCATCATTCAAGTTGGGGACTTTAGTCAAGCTCTCTTTTGTAGATTTCT
CAAACCTAAAACTATTTTTATCTTTGTTCCAACCAAAATAGGAAAAGACTCACATTGCCCATACTGTCCTCACCTCCTATGAACACCTCAACCCCACATGACTGCGTACCAACATGGAAT
AAGTTTTCAAAATGGATTATGTGACTAGAAATCTACAATACCATTTGTGTAACTTTCAGGGTTGCCATTAATCCAGATTCAAATGTCTAATGTACATCTGATTGCATAGTTTCGAGGGTC
CAAAAATACATGCTAAGAAATAGAGTAGAGATATGCAATTCCAGTAGGTGCATTAAATAAAAAATAATAAGCAGAGGCTCCCATAACGCAAATCCTATAACAGGATTATACATGGGCATG
GTTATACGACTGTAAAGAAAAAGGGTAAAGTCCCATCCAGATGTCCTATTAAAGGTTATACAACTGTACATGATCAGATTTCAAAATTCAAAATTACAAGACTAGGCTCAACAAAAAAAG
AAGACATTTTTGTAGAATTTTATCTAACCAAGAAAAACAAACCAGTGGAACATTCACATTCTTGGGGCATACACATAAACAGGGACCAATTAACAGAATGCAAATGACATAACTAGTTTG
CCCTGGGGTTTTACTTATGTTTTCACCAGAAATGAAGACAATACTTATGTTCTAGTTGTAAAAACCAAAACAAGACTACATGTGGTGTAAACTGGGAAAAGCACTCTGGTGTACCATGTA
AGCGGTAATATAGACAGAGAAAATAAAACTCTATTATACTATTAGCACTTCCATTTAGCAGATTTTGAAGACTATAAGAATCATATACCTAGCATATTCATCTGTTTCATACTATGAGAC
TATCTGTTATGACATGATAATTAGCAAATGCATATATAAAAAAAAGAAATAAATGGTATTGTCAATGTTGCTAAGCTTTGCAAAACAACCAGCATAAATTAAAGAGGATTAGAAACCTTG
GTAGATCGTGAATCTGCCTCTCTGCTCCTCTTTCTGTGGTTATGCATGTCAGGAGAGCGGGTTCGTCTTCCAGCATGTGATTTATGAGAATCCCTTTCCTCTGCATGTGATTCATGAAAA
TCCTTTTCCTCTGCATGAGAAACATTGGCTACAACACTTCGAAGAGGAACTGCTTCTGACTGTTCTCGAATAATTCTTCCCCAATCTCTTTTCTGATGAGCTATAGTTGTTTTCTGGGCT
TCAGCTTCAGGTTCACAATTAACTTGCACGCTGCTAGTCAAACTGCGAACAGGCAATCCTCTACCAGCACTGTGAGTGCTTTTAGGTTCATCATTAGAAGTGGTGGCTTTAGGTTGAACA
TAAAGGTGCAAATTTGAGGAGAGGTGATCCCATAACCTGCATAATCGCAGATAGATTGATCGTGTTGTCAGAGGAAATACATGGCAGAGGAAGAGAAATGAAGTGCGAAAGCTTCGGGTG
AAAGAAGATGACCAGGATACAAATGCATCATTGTCGTCGCCCAAAAAAACCTGCAGCTCCTTTGCCGCCTCATCCTTGCACCTCCCATTCCTTAGCAATACTACGACATACTCCTGAGCA
ACAACGAGAAGAAATTGATAGATCAGCAATCTTAATGGATTATGATTTGCCGCAACGAGAGAAGAGCGCACCTAATATCAATCATATAAATTGTCCATTACAATGTTCATCAACAAAATT
GAAAGAGCTCAGCCATGCGCTTTAACCTCCACTCCAGACATCCTGGAGTTTGCTAAAACACACACAACAATATAAACACACTTTGTTCAAAGATTATATGTATAACCGATTCCATATATG
GCTAAATGCCATGTATCAGACTACAAAATCCAAGTTCCAAAACGTGCGGGGGTAATCGTGTGCCGCTAATCCTCAAAAGCACATGAACCACACTAAACCCCAAATGCTGATAACTAACAC
GACAGCACACGAAACCGCAAGTGCGGATAACTAACACGCCACAGCGCACCACGACCCTATAAAGGAAACCAATCAGATAGCCGCGATTCCGCGACATCCCATATAGCCGCGCCACCGTCC
CCTACGGGACCGCATTCCACGGAAGTGCCGGGCGACGCTAGGGTTTTAGCAGCGGATCGGGGGATCGCGCCGCGGCGCGGGAGGATAGGGGAANNNNNNNNNNNNNNNNNNNNNNNNTCA
CCGCGAGTGTGTCGTCGGAGTAGTCGCCCATGAGCTCCCTGAGCTTCTCCTTGACGCGGTCCTGCAGCAGGGTCACCCCCTTGCCGGTGAAGTTCGCGTTGAACGTCCGGCCCTCGCCGC
CGTCCATGGGGGAGGAACCCTAGCTGGCTCGACGACGCCGCCCCCCCCTCCCGCACCGGCCGCGGCACCCCCGGAAGTTCACCCGGCCGAAGCAGCCGCGTCCTACGGTATGGCGCAAGG
GGGGGTACGGGGCGGAGGCGGCGGGGATGGGGGGAGGGTGGACGGATACGGCGGGGAGGCGGCGGCACCCGAACGCGAGCGGCGCTGGGGTCTGGGACTCTGGACTCTGGACCGTCGCGG
GGGACGGACGCTTCCCGTGGGTCGTGCGCGCGAGGTGTGAGGTTGCTTTGATGGGTTCTCGCGTGTTCTGGGCCCTGAACGAACTGATTTGCAGTTGCAGGTGCGCACGAGCGAGCGGCG
GATGGAGCGTGTGTTGGGCTGTGTATCAGACGAGATTTTCCGGCCCAGTTAGGCGGCTCCAATTGGATTTTGCTTAGCTCAGTGGACCGCCCAGTTCGTTGTACGCACCCTAACAGCCCA
GACACAACTGAACGTGAAAACTGTTCAACCCGACAAGACCAAACCCAGAATGGGTTTGGTTGGGTTTGCTTCAAGAACTCGGTCTGTAATTATTTTCTTGGTTAAAACAATGTCCAATTA
TTCCAAGAAAGTTCACGTAGCTAACACATAAAATGAGAAAAGAGTAAAAGTTTGGACATCAACATCATCTGCCCTTTGAGAGCTGCAATTCATCTGCCTTGGATTGCACTTGGGAAGACA
ACCAAGCATCAATTCTTAATGGTGTAACACATCTGTAGCAACTTTTAGTTGAAGCAGCATTATATAGGATAACCTCATCGCAAATTAAACTCCTCGTGAAAACTTTAGATAGATCTTGAT
CTTGATGTAGATGTGTGTTGACAATGACAACACTTGAACTTGTGCTGGCTAGCATCCGGGTATGCCTAAGGGGTTGAAAGGGGGGCATGCCCCCCCCCCTCCGAAGCTGTTTTAACATGC
TAATCATTAAAAATGAAATCAATTCTGTGTTTGTAATAGGTGATTTGTTACAAATTGAATCCCCCAATGGTTTTGTTCTGGCTTCACTACCCTTGTACGTGTAGTGTCTGGGGCCTTGAG
TTGGCTTCTGAGAACTTGTTGCAACATTTTGTGAATCAATATATGTATCAAAAATGTATGTCTAAGCTATGTAGTGATGCATTTCTGAAACATATATATAGAGCAATTTGCAGGCACCTG
AAAAGCACAAGGAATAAGATGGGTCTCATGCCGTCACAATCGCTGCTTGCCCTTATATAGAACCCATTTGTATAAAAGGTAAAGTTTTCTCTGTGATATCTTGCTTAATTTGGAAATAAA
GCAACAGTTGCACAAAAATAATGGAAGGATTTGAATGGCGTGGGACTTTGCCTACTTGTGCACTTAAAAGGAAAAAAAAACAAGGAACCAGGTGTATGCAGGGTTTGGTTATTTGCATTG
AGGTGTGTAGGTCGTCAAGGCCCATTTCGAGTCTTTGACACTAGTATGAGTGAGTTCACCTTCAGGTTTCGGGGGAATTTCCTTTTATATGCCACCGTGAAAACCTATAATTTCTCGCTC
ATATGCCATCGATGTGTGTGTGACACATAGGATCCCGCAGTCACTAACGATGGTATATGATGGATTTAGGGTTTAACCAATGGCATACGTGTGGATTTTTTCTTCTTCACTTTATCCTCT
AAACTCGCACTCGAGAACAACCTCACTGTTCACCGTAATTCTTCCATCATGTTCATGTTTTAGTATGCGTTTTGATTGTTGGGCTTGCAGAACTCTACGGCGACGTATGCCTCTCTGGGT
CGGATCCAGGCTTCACCTGCCACAGCCCGTGCATGCAATGCAACACCCACTGCCCTCCACCAAGCAACCGCCTACCTGGTGGCAGACTAGCAGTACAGTACCTCTCACCCTCGATCAGGA
TCCACTGCACGAGCGATCGACCAGCGGACGTCCACAAATTTTCAGAATCATCCACTTTCCAAAAGCGCACGGCCGATCCTGCGGCCGTGAACCCCCTGCAGCCCCTGCTAGCTCCGGCAT
TGCATCCAGGACCNNNNNNNNNNNNNNNNNNNNNNNNCATGCAGTTGTTGGTTTGGTTGCCTGGTTGGTATATACGCCGTGCGACCGTGTCCGGTGTCCATACACGCAAAAGGCGCCGGC
CTTTCTACGAGCCTTTCACCGACGTTGCCACTGGCGGGCACGCACGCTTGCTCTACCTGCTACTATCTCGGAACTGTGCACTTGCGATGACAAGTACTACTCGTCCAGTCATCTGAAGTT
CTGAACCCAAGTCGTCGGCGCCCACATGCAGAGTGGCACCATGATCGGAGGCATGCATGCCCAAGTCAAAGCCTTGGCTTTCCAGCAGCTAGAGCTACCTGCACGCGCTGGTTTACCAGC
TACAGTACTAGAAACTATCCCTGCAGGCGGGCAAAACGATCGTGCAGGAGAAGAAGCAGCAGCCTGAAAAAAATCCAGCGTTCACGTCTGGCAGATCGCCGATCGATCGATGAGATAACT
GCAGATGGCCGAGCAGTTGTTTTCGGCCGTGATGACCAGCCCTCCACTAACCTCTCGTGCGCGACCTTTCCCAGCTTTCGCGAGTGCTCGTCCCTCCCCACAGCCCCACCCAGTCCACCA
CCAGCCTTTCACCTTTCGAGAAAAAGACTCCTGTCCAAGTCCTCTTAACCTTGTCATAGCTGCCATGAGGGCTTCGTTAGCTTACGAGTGAGGCAAAGTGGCCAACCGTGTATATAAACC
AGACATGGCTCCGATCGAGCTCTCCAAAGATGTCATCGAAAGCTGTTGCCTCACGAGAGAAAGAGTAGCTCTTGCCAGTTTGAGCTAGCAGAAAAAAATGNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGAGCTATGTGGGGAAGCCGTGCTGTCGCTCGTCCGGCAG
GGCATGCCGCGCCGCCGANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCGCGCGCGCCGCCGACGAGGTCCGCCACCTCATGGCGCGCGAGAGCTT
GCGCTTCGTCATCTACGCCTAAGAACAACACGCCCGATCGCCGCGCGCATGTCTGCGTGTGTGTGTGTGTGCAGGAGGCAGGAGCAGAGAAGATACATGTAATTAAAACCATTGCTCATG
TGTCGTGATTACCCCGTATCTTAACCAATCGAGATCGTATTTAATCTGCTCCAAGATGATTAGTTCTTTCGTGCTTGGATCCAGACCGGATCATCAGCCAAGGCCCCTCCCGTTTCTCCT
GGCCGTGACGAACTCTGGCAAATGGCAGCCGGCGAACTTGCCAAGCCAGCAGGGGATCCGGGCACGCTGACCACCGTGCCCGAGCGAGCAGCGATTACATACCGTGCGTCTGACTTTGCG
CGAGGATCGCACGTGGTGGACGTGGAACCGACGGCCACGCGGGCCGTGACCGGCGAACAAGTGGCCAAGAATCACGGCGGCGCGCGCCTCCAAAGGAAGACAAGGGAACCGTGTCCGTGA
CCCGGGGCTCGCGTGCCACGACATGATAAGGTTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNTCTCCAGTGTCCCCCGTGGCGGCTCCGTCGGCGGAGAAGAGGGAGGCGACAACGGGGTCGAGCCACGCGAGGAGGTCGTGGAAGTAGGGCGGGGGCAGGGATCCG
GGTAGGCGGAAGGAGGCGCGCGGCGGGTGAAGGCGGCGCGGAGGAGCGGGAAGGCGAGCGCGGCGGAGGCGAGGGTCTCCTGCTCCCGCTGCTCGTGCACCTCCGGGGAGGGGTTGGCGG
GAGGTCGCGGGGTCCGCCTCCAACAAGTGCCCCATCGTGTTGGTTTTGGTTAGATCTCGAGCTTGATCCACGCTAGGCACCGCGACGAGGAGCTCCAGCCCTGATAGCGATTGGAGGCAA
GGGCAGGCAGTCCGGCAGCTAGGGAGCGGCGGCCGACGCGGGCCGGACGCGGCGTGGAAGGCGGCGGTGGAGCGGCGGCCCCCGTGTTCTGGCTCTGGAGATCTGTGCGGCAAGAACAGG
AGAGGAGGAGAAAGAGAATTGGAGAGAAGGAGAGAGAACAATGCAGTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCCAATCAGGATCTAACTAGATAAGCCATGCCAATGAGCAAGTTGCTTAACCTTAGCTTTCAGATGAA
AAAACGAAAAGACGATGGCGGGGTTGTTCACACACACGAGCAAGAAGGATCAGGTGCTTTTTTTTCCTGGACAACTTATGCATGGATTAGACATCAGATATACTTAGTAGCGATCAATGT
GGCCGGGCATCGCTGTGCTTACCCGAACAGGGTCATTACTCGCATGGGAGGAACCAGCTAGAGTTTCAGGATTATTACAGGTCGGTATCGGCGTCAGGCATCAGATATAGCGCACATGTG
CAATCCAACCAGGCGCCTATGTATAATGCTTACGTTGTCATGCGCGGATGTAGCACTATAAGAAACTATTTTATCAGTGACAGGTTTTTCGTGACGTTTGCAGAGAACGTCTGCAAACGT
CACAAACGGTACTGCATCTATGACATTTTTCTATTTTACACACAATGACATTTTGTTAAATTCGTCACAATCTGACCCACAACGTCGTGGCGTTTTAGCAAATTCATCACGATGAATAAA
TTAAAAATCATCATGTTATGTATGGAAAAAATAGAAAAATTGAGGGGGGAATCGGAAAAATACGATCAGTAAATTAAAAATCATCATGTTGCGTATGGAAAAAAAATAGAAAATCAGCAT
AGGTCTTGAATCAAACATGCGACCTCCAAGATAGAATGCACTTGCCATTGAGCTACTTGTTGTTTTGTCCACTTTCATGATGCCAACCCATCTGTCAATCTTTCATCTGTCGGGGGCCGT
CATTGGTTTATTAGAATTGACGTGAAAAAGGAAATTTATTATAATTTACGTGAAAAGGATAAAAAAGGTGGTGGCCAAGGGAATCAAACCCAAGACCTCAAACCAAAGCCAAGTGCACCA
TATCATTGCACCACTTGATTCTTTGTGATTTGCTTCGGCATACGTTATTCTTATCATATTTTCTGCGTCAGGATATCTTGACACACGGCAGCGAGCTATTGGCTAAGCGGCTTCGCCACG
AATCCCGCCTAGGGCGATCCGTGTGCCACCGGTTAGGCCAATCTCGTTGTGCCACGAGGCTAGATTGAAGAACAAACAAACAATTCGTATTTCTCATTTTAATCCGGAATTTAAACTTGT
ATCTGGTATTTCTCCTTCATGGCGACTTCAAATTTGATGATTCTTTTTTCTAAACATGTATGCCCTAGCAATTGGTAAGCTGCAACTGCAAGCATGGTAGAGGTGCAGCCATTGCTGTAG
GGTTGTTGTCGGGCATGGGCGATCCATGGGTACTTGATAACCCAACAAGCATGCACTACTAGGAAAGTTCCTATCACAGCCGGTCCTAAAACCCCTATCACCGCCGTTTTGAGCCGGTGG
GTGTGTTATCACCGTCTGTTCGAAAAAAATTTAAAATATGTAAAAAAGATAGTTTCAACCGGAGCACCTACCACACAATCACCTGTCACAAGGGCCAACACGTAGTATTTTTAATGCAAA
ATTAGCAAGTGTACGGAATCGAGACTCAAACTCAAAACAACTAGCCTCGTGATAGCTTTCTTACCATCACACCACACAATCAATAGTGACTTAGAAAAGGATGATATTTCTTTTGAATTA
ATTGTTTTGAATCTTGTATGTAATATTTATACACTAAAATAATTTTGAATGAAAAAGTTATCAACTACAAAATTGTAGATCTCATTGAGTGCTACAACTTTACTGTTGACTTTGTTACCA
TTTGAGATCATTTGATAGGTGTGATACTTATACCAAATATTTAGGCATCTAAATAATTTTAAATGAAAAAAGTTGTCACTAGAAAATTTTAGACCTGGTCGAGCTCTATAATTTTTGTAT
GAAGTTTGTATTCATCCGACTTTATAGAGCTATAGAAGCTATTAGCCTGGGGTCGTGACATTTGTGGTTCTGTAAACCTAGAAACGTCTTCGCCACTGGTTCAAATCAAATCGGCAGTGA
TAATTCGTTGGTGATGATAGTTTCTGTAGTGATGAGTTTTTAAATAGGTTTAGATAGGTTTCACGTTTGTAGTGACGAGACCTATCACGCGTGGGGACAAAACGTATACGGAAAAATACG
AACTCCAATTCGAGCGAGCCGGAGATGCATTGAAGTATTGCAATGATTACGACCGTCTCGTGGTAATTGCGGGGGTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNCTTTAGCTTGAGAAACCGAACAGCCCAACCATTTTCTTTTTAGTTCCAGCAGCCAAGCGAAAAAAGCATTTTGAATTTTGAACGAGGCGGCG
ACCGGCGAGAGGAGACGTAGACCGCCGGCGTGCAGGAGAAGCCATCTCGCTGGTGTGGTGGGCCCTCCAGCCCTGCGGGTGTCAGGCTCTACAAAAACCCCTCTCACCGCCTCAACCCCG
CCTCGCATTTCCAACGCCGCCTCGCCTCGCTCGCCCCCTCTTCTCCGACGACACCACGCCGCGTTCGCGAGAGAAAGCCTCCACCGCCAATCCGCCATGGCGACCAGTGCTCCTCCCGTA
GCCCCCTCGCCGTCGAAGGAGCTCCTCGTCGACGACGTCTACCCGAGATCCTGCTCCGCCTCCCCGCCGACCGCCCCAAGTTGATGTACCGCTTCACCGCCGTCTGCAAGACAGATGGCG
CCGCCTCCTCGCCGACCCGGCCTTCGTCCGCCGCTACCGCAAGTTCCACGGACTACCGCACATGATCGGCTACATCCACGACGGCGGGGAAGGACACCATCTGGAATCTGGTTGCGAGCT
TCGTCACCACCGCCACCACCCCCTTCAGCCCGCGCGTACCCGAGAACGGCGTCGGTCTCCACGTCCTGGACAGACGCCACGGCCGCGTGCTCTTCGAGAAGTTCGCCGAGGGATGGGGCG
AGGAATCGTCGCTCGTCGTATGGGACCCCGTCGCCGACCTTCACGAGGAGGTGCGCCTGCCGGAGGCGTTCCGGTTGGACGCCTTCAACTTCACCGCCACCGTCCTCTGCGACACCCCGG
GATGCGACCACCTCGGCTGCCACGGCGGCCCGTTCCGCGTGGTGTTCGTCGGCATCCACGACGAGGAGGGTACGTGGGCCACGTCCGCCTTCATTACGCCTCCGCGTCCGGTGCCTGGAC
TGCTTCGCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNACGAGGACGACTGGGGGTTTCTCGAGACGGCACCTGCCACCTTGGTGGGGAGCACGCTCTACTTCAGGAGCCCAGG
GAGGACTCTCCTGTACCAGTTCGGCGACGAGGTGGAGCAGTTGGCCTACGTCGACATCCCGCCGTTCATCACCCAGCAGGCCTGCGGAACGGTCCTCATGCCGGCGGCGGACGGGAGGCT
CAGCTTCGCGGCTATGTACGGCGGCGCCGGCGCCGGCGACATGAGAATCCAGTTCTGGGAAACGGAGGTCCACGCTGGCGGTGATGTTGATTGGGTCCACATCCAGAACGCGCTTGTGAA
GATCCCTGTGCCTGGAGTTCAACCCATTGGCGTCGCCGCGAGCTCGCTGTTCATCCGCACACAGGATGATGGAATCATCAGCATCGACGTGGGGAGCGGACGGTTCCAGAAGCTACCCCA
GCCAGGCGCTACCCAGATCTCTGCCCTCGTTCCCTTCATGAGCTTCGGTACCCCATCAGGTAATGCTCAAACCTGCCGGGTCTGACGTTTTACACTGAAGTTGCTGCTGTTTGGTTCAGA
GTCCATTCCAATTTGCTTCGGATTGTGATTCCGCCTAGTTTATAGTTTTGTTTCCTGGTGTTTGTCATGTCGTATCTTGTAAAGTCTGCGCTGTTAAATGCTTTCAGTTATGAAACCTCT
GAATGTTTCCAGCTTAAGCAGATGAATCTTTAATCATGTTCAGTTACTAGTAAGTTTTGTTTCCAGCTGTGGAATTAAAGAGAGGACAGAACAGTTTATGTTGGATTTGTTTTGGGATCA
TGAATCTCTGCAGGTTAATATTTCTGAATAAATTTTCATTTTGGTGATATGGTGAGTGCATGTGATTCCTGCTGAAATTGCTCGTGTCCGAAGGCTTACCCTCTGTTGATGCGTGCATGT
GATTCCCCTAGTTTCTACCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTAACTGTTCTGTCATGGTTTACGTTTCAGACTTGGTAACTACTGTTTCAGAGTCCAATTGTTATGTTG
GAATTGCAGTTCAGTCTTCAGTTTCAGCGTTCTATATTGTTCCGGTTGTCAAATATCGGTCTACACTGATTTGCTATGCTTGCTAGCTCGTTCCTAAACTGTCTTATCTACGTTTAGAGT
TACTGGTGATCTACAGGTCCACAACTCTTTCATGTTTACGTCTACAGTTACGGGTCGTTTCTGGTCCAAGCATTCAGATCATGATTTCTGTTTATCTCAGAGCAGTTGTACTCGTACATT
CATGGCTTGTTTGCTGTTCTTACTCATTCCTGACGTATTTGGACAGATGGTGGAAGTGAAAAGAGTGGTTCCATTGAAGTATCAGGCCCACGCTATGCTGATGCTGTTCCTGTCTCTGAT
AGCAACAACTCCGATGATGCTAAAGAAGAAGAGACTGCTTCCTCACAGGTGATCTTCAGGTTCACAACTCTGTCATGTGTTTTTCGAGTTACTGGTGATTAGCGCTTGTGATCATGATTG
CTTTTCATCTCAGACTAATTGTACATTCAGGGCTTGTTTGACTGTCGAGCAATGCAAAAGATTTACACTATCAGTTGTGTCTTTTCAGATTCTTCTCACCAGCTGATGCCGAGGCAGAAT
GACCAGGAAAAGAAGCTGATGGCTACCTGTGGCATTCTGGTGGAAATGAATTAGCTTGTGGAACTGAAGCTTGAATGGGGAAATTGCTCATGTTGCCGGGCATATGTGATTCGCCTATTT
TCCTAGTTTTGGTTTTCGGTGTTTGTTGTGTGACTCGTGTCACATCCTGCAAACTCTTTGCTGTTAAACGCTTTCAGTCACTGAAAACTCTGAATATCTGCTCAAATATTTGGTTCATGG
TAAAGTATTTGTTCGGTGTAGACTGANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNTGAGTTAGTAAAAAATAATGAGGCATTGTGGTTGATTATGATTCTTATTGTCCGAGCGTTCATGTCCACCTATCTCAGTTGATACATAAATCTCACTTTGACATGACAA
GTTTGAAGTTACGATATAACTCTTGATTAATCTGTTCTCTGCAACAGTTAATTTTTATCCCTTCAACAAGGTTGACCCAGTGCTATTTGCAGCCTTTTGGGGCATGCATTTGAAACTGAG
AAAAATCCATAAATTACTTTAAAAAGTTGCCTGGATAATGAAGCTGCTAGTTTCAGTATTTCATGACTCTTGAATGAGATTTGTCTGCACAGTACTTTCAGCCTATGAAGACAACCTTTT
TGTTCTGCTGAATGTGTTTTGTTTCATTGTCTTTTAACTACTGAATGTGTTTTGTCCATCTAATGCTATCAGCTTGGAACTGAAAAAGTTGGACTTGCAGCTCAGTTTCTGCAGATAGTG
AATCAGGTGGACAACTTTCTGAACAAACATGGAATTGATTCTTGGATACAAGAATTTAAGCTGGCCTGTTGCTTGTTGGGTAATTTATTTTTGGGAAAAGCTAAATTGATTAGTTCTTCT
GCTGGAATAAACCGGAGAGAATCCGAAACAAGCAGTTTCATGGAGCTGCTGGAAATAAGAGCTGGTTCTCTTGCCTCAACTCATATCTATGGGCCNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTATCTTTTGTTGGGGGATTGTGCTGATTGTTTTTTTTAATAATT
GATTGTGCTTATTGTTGGGTGAAGGCTTCATAATCAATGAGCTGCGGTGCGCAATTGCGCTTTTATCCACACTCTGTAAAACTCCAGGACACCTTCACTGCGGTAATTAATTTATTGCAA
CAGGAAAAGGTTAAATAGCTTGATGATACCAGGTTTTGACAAAAAAGAAAAAAAATCAAGTCATGATCCGTAGCTACTGCAGTGTACAATCTTGGCAAAACTTTGCTAGAATGGAAAATG
GAAACCAAAATAAGCATCCATTACATCGAGGGCTTGAGGCCATTCATCTGACTCCTTGACCCCACCTTACAGACTCTCTCTATCGCAAGTTGGTTGAACCCAACCAAGTAGTAGCCTCCT
AACCCGCACCCAACCCGACGAAGCAGACAGATGGCGCCGCCGGAGCTGATGGGCGACCTCGTCGTCGGCGAGATCCTCCTCCTCCGCCTCCCGCAGTTTTCTTTCCCGCGTACACTATCT
TAATTCTAATAAAATGTTTCAATTGTTACAATATGGTTGTCACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGAAATAGTAGAGATAAAAATTCATCA
CAAATATTAACTAGAGTACATTACATATGAAATTCATCGTACATATTCAATCTTACATAAATAAGATACTTAGAACCTAAGATCGTCCACATCATGACCGTTAATCATCGCAACATACAA
ACTACGATTTATATCGATAATGTCGATTCCTAAGACCCATTGACATAATCTAGCGCATATATTAAGTCTTACTATATGAGATATTTAGAACATAGGATCGTCCACGTCACGACCGTTAAT
TTGGGAGACAAAAAGATACACCAATTTTAAAATAATGGTACAACTGAGATCTACGAGTCCACCTACTCTAGCTGAATATCATAAAGGAATCTTGAAATAATTGTCTAAACGTCTTTTGGA
GCAAGTGCCACATTTTCATAATATAAGTATGGTGGTCCAATAGCCTATCCAAGCAAAAGATCTGTTCCCTGAGCATGACCCATTTTGGCAATCCAAAACCAACCATAAGCCGATGGGTCA
AGGTTAGTGAACAAATCTCTGGCTGAATCGGTTATTTGCCACCATATTTCTATTATGAAAATTTAGCTCCAAAAAGTGTTTGGAAAACTATTTCAAGATTCTTTTATGATGTTCAGCTAG
AGTTTGTGGATTCGAAGTTCTTCTGTTCTCTAGTATTGGAGGAGCAGAGGTGTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCATAGAGCTTCGTATTAGATA
AAGAACTTGATCAATATTAGGTAGGGGAAAGATAGATTAAATGTGTTTATAATATTTAGTCCACGCTCTGAAATACTCTCCATTCTCCTCATTTCTAAAAGATCAACAAGTACTCCATTT
ATAACATAAAACTCATTCTAAAAAACTCTCCATTCTCCTCACTTAAAAAACTTTCCATTCTCCTCGTTCTGAAAAATCAACAAGCTAGTAGTACTCCATTTGTAACATAAAACTCATTCT
AAAAAACAATTTGAACCAAGTATAAAGAATCGTTAACAATTTGAACCAAGTATATGAAACCATATATAGTTATCTTGGTTCTTATGAGATTGCAAGCTTTTGATTTCATATAGTAATCTC
TTACCTAAAAAGCGATGCATCATTATACATTTTGTTTGCTCATCTGATTGAATATTCATGGATCATGACTTCCCAAAACATATCGGAGTCACGTGGTAAAGTCTAGGCCTCTAGGGTTAA
AGATATGTGTGAGTAACTTGTTACATATGAAGCTGCAAGCTTCTAGTTGCCCAAGCCGATTGGTGCTGAATCAAGAGCAGGGGAGCCATTGGTCATGCGTTTATGCTAAATGAAGTATTA
ATTGTTGTCATATGTTGGAAGAAACTTATGTAGATCACAACAATGAAAAACATGCATGTGTAAGGTACGGAAGTTAAAGAAAGGGCACACAAGTGGTACCTGGAGTGTAAAAGCATGTAT
AAGGTAAGATGTCATAGTCCTATCTTTCAGCGACCTTTCTTGTCTTGAGGTCGAGTGTGAAGACTCCCCAAACTACGTAATTATTAGGTGAATAAAATAGTATTTGTTCCTTCTACGAAG
CGAATCACATCACTTGGGTGATCTCGGTATGGTGAGCCACGATGTTGGGGGATCAATGTCTGGAGCTCCGCAACATTGTGTAGCATCCATCCTCCAATCCCATCCTGCTGTGACCACGTA
TAGATGTACTTATCGACGAACCCTAGCCCTCCATCAATATCAATGGGAACAGACTTGTGAAACAATCGCGGTATTTCGATCACGGACAACCCATGCCTACTTAAGTCATACTTGAGGATC
CTCATCGCACCAAGGGTGAAGTAGAGCGCACCTCCGATAAGAAGGCTGGGTTCCCTGACCGCAATATTATAGTAATGTTGTTTATTAGTACCAGAGGTTTGGGCGCTCCATTCTCCTGTC
TCTGACAAGTACACGCTCGCCCACGTGTACCTGACATGATCCACGTCGATGGGATGCGCCCCCTCTGTCCCACCCACAAAGACCACGAGGAACGGACCGCCATGACAATCGAGGTGGTCG
CAGCCATCCACAGCGCATAGCACAGCCCCAGTATAACAGCACAAATTCTCTTGTGCGTGAGCGAGAAAGCTCAGGTGCTGCCGGTCGCCAGTGATGGGGTCCCAAACAATGAAGCCTGGT
GGGCCGCTAGTGTCGATCAGCAGGCCATGGCGGCAGTCAAGGGCCCTGTAGGAGTTGCGGCTAGCCGCCAGCGACGGCGGGAAGAAAGTAGTGGTTGGGACGAACTCGAGGCCTGCACGG
AAGCCGAAGTTGTGGATGTAGCCTAGCAGGGGACGCGTTCGATGGAACGTACAGTAGCGGCAGCGGAACCCGCTGTCGAAGAGGATGCGCCTCCAGGCCTTGCAGACGACGGCTGCGCGG
ATGAGGTGCGCCGGCTCGTCAGGTGGGACGCGGAGGAGGATCTCTTCGACCATCAACGCCGGCAGCGCCATGTCGCGTGCTAGCGTTGATCAGGTTGGCTCCGATGCGGACGGCGACGGC
GAGACGATGCGACAGTATCGGGACAAGGAGGAGGAGGAGTCGGTTCCGGACTTGGGTTCGATCGACTTGGGCGACATATATGGAACCAAAGAATAGAGTTCGCCCAACAGAAAATCAGCA
AGAAGCTTCAGACTGAATTTTCCCAGCCTTGTGCCATGCCTTTCCATCACTATTCGCTGCGGCCTGTTCGTGATCTTTCAGAGCCCGTGTCCAGGTACGCGTGTGGTTATATTGGATACA
AGAACAAGGCACTTCATCCCAAACANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCCTTGCCTTGCCTCTTCTTTTTCCTTATCTAGCGTGTCTCGATCTCTAGGG
CAGTTCATCCCTAGGCACTGTTCACTCAGTATGTCAGTAACCAACTGTAACCAACGGAGAGCATCCTTTAAACTTTTCAGGCACCGTATACGCTAGTTGCTTTATAAAATTGCCTATGCA
CAACAGTGCATTCTTTGAATCCCATAGTAATATGGGATTGCATCTCCAACGCTAGCTGCGAGCACAGAGACCAAACTAATGCGCAAGTTTCTAGGACTACTTAAGGGGAGCAACCATTAC
ACCATAAAGCATTTGTGCTGACAGCTAGAATAGATTTGTGTTGGCGGGTATCGCACCCGCCAGCAACCTTGAGCCAGCACAAATGTTGTCTGTGCTGGCGGGCGACGTTAGCCACCCGCC
AGCACAGATACTTTCTGTGCTGACGGATGGTTACATCACCCGCCAGCACAGATGGTTCCAGGAATATGTGTTTTCCCGTTCAATATATTATTTCCCGTGAGTTATTTATAATTTCTATTT
TCCGCCAATTTTTAGCTGTCAAATTAAAATATGTATCTCCAACCACATAACAACAAACTTGAATAATAAATAGTTCACATTATCTGTGCTAGCGGGTGCTTATATCGCCCGCCAGCATNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATAATCCTC
AANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGAATTCGGTTGTAGCTAGATTAGACTCGTTTGGTGTTTACAGGAGATTTATCTCTATAACTTATCTCT
AACCAAACTGAGTCTTGATCAAGTACAGATCTGCTAATTCTAGCAAGTTGTTCGTCTCCGATCCCGTCCGTCGTTTGCTATGCCGCCGACGTTACCATTCTGTTCTGTTCGCGATGCTGG
TTGTTTTGTGTTTCATCACAATAAAAAAAAGGGAGCATGCACAAGCATGCCGTGTGTGTGCATCACGTCATCCCTTCTTGTTGTAGTAGCCAACCAGGCGAGGAGAGCATTCGGTGTGCA
TCTCTTCCTTGGCATACGTCACATATCCACACTATTTACTGTAAATGAGCCCGTGCTTGCGAGTCGTCTGGGCCGTTCATCAACGACAATCCTTTTGTTTTCTCGGAACAATTATTGACA
GGTCCCCTCCCGCCCCTTGCACTGGATGCTCAAACTGCTCTGCGAGCGGATGCGTCGTGGCTGTACCGTACCGACCGTTGTTTGATCTGACACGACGCAGGGGAGGAGGCTCCTGGTCCT
GGCCTCCGGTGCGGCGGCAGCTCAGGTTCGCTAATGATTTGCTCGAGGCCGGCCGCTGGGATGACGAGCCAGGACCGACGCCTGCGGCGTGCTGCACCCGTCCTCACTCCTCACTCAGGC
ATCCTCGTCATCTCTTGCCAGTTCTTTCCCCCCGCACGTTGAGAGTCCACTTCCCAAAAGCGCGCGGCAGAGATCTTCCAACCATCTTGAACCCAAGTCTGCAGACGGACCGGCATGCAG
AGACCCATACGATACGAGATGGCGCACGAGTCATGCGTTCCGAGTTGAATTCTTAGCTTTCTAATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNATTCCTATTAACGGAAACATTTATTAGGAGCTGTAGATGCTCTAATACTAGCTGCTAGCTAGCCTAACCTAGGGTTGGCTACTGCTTGGCTGTCT
AGATTCTAGCCCGGCCGGCAAAACGAGCGATTAAGGAGCCTGAAAACCCTGCGCTAATTCCTGGCCGTGGCCGGCGCCGAGCAGTAGTTTTCGGCCAATGACCGTCCCTCCTCCACTAAC
CTCGCAACCTTTTCAGCTTTAGCGAGTGCTCGTCCCTGTCCCACAGGCCACAGCCACAGCAGACCCCCACCACACCCGTCCTTGTGCCTTCATCCTCAAGACTCTGAACAGTCCAAGACC
CTTTAACCCTGAAAGTTCCCATGCGTGCTCCGTTAGCTCACAAGCGAGATCGATCGTGTATATATACGCGGCACTACACGCCTTCGATCGGGGCGAGCTCTCCACTCCAACAGATGTTCC
CGAGTCTGTGGACTCACAAGCGACGAAGATCTCCATCCAAGTAACCAGCGAACGAGCGTGCGTGAGCTTTGGGAGCAGAGAACCAAAAGGGAAAGCTGGTTACTTGGCAGTCTGATTCAT
CAGCGAGATCGTGTCGCTGATCTGATCGTCTTCCTTTGGCGATGTGGGGCGTTCTGTCTCTTGTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCTGCAGGCGCCCTGGCCAGGGCGCTCCTGGCGA
TGGCGTGCGGCGCCGTCCGCCTCGGCGGCGAGGATGCCGGCAGCGCAGAGGAGGCGTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNACGAGGTCAGCCACCTCATGGTGCGCG
AGGGCATGCGCTACGCCATCTACGCCTAGGCGAGGCGCCTCTCTGCCGCGTCCTGTGTGTTGCACATGTGTGCTTGTATTCGTAGATACACACTAGCACGTTCACAGCAGTAGTGACCTG
TACATAAACGTGCATGCCTTGTATGCACTACTTGTCCTATCATGCTTTCTAGTTTTTTTTATTTCCTTTCTCTTTGAGCTGATCATAGCTAGCTTATTGGCGTGTTCTTGTGCTGGACAG
TTTGACCCCTGTCCCGGCGTCCCCCTCTCTGTTTCATGCTTTGTTCGAAACTTGGAAGTTCATGGAACTCGGCATGCTCGCCACAACATTGATGATTTCACACCGATCAGTGCGTACTAC
CTTGGATATAACAGTTTCTGTTGGAGTGTCTATTTGGGATCTTGACACTCGAAAGTAACCGGACCGATGTTCTTGCGTTCTTTTGGAAGCAGCAGCAGGATAGAACATGGATGTGACTTG
TGAGACGCTCCTGCCCAAACTCGTACTAGTGATTATCCCTGTTGTAAAAATTCAGGCATGAACCCCTCGATATTGGGTTCTTTTTATTTTCTGTTGATAGTGGATTCTTTGTTTTTATTT
CTTTGATCAATTTTTATAGTGGATTCTTGATGGCACTGGTAGACTCCTGTTGACATGATACATGTACGGCAGTGGGCTACGTGGGTTTTCAACCGTCAGATCAGACCAACAGAACAACGG
CGCCCTCCCAAATTCAGAGGAACGACTGCAAATCTCTAACCACCGGAATACCGGAGCCGCGGCGATCACCGTGCCGGTGAGGGTCTGAGGGAGCTCCCGGGTTGGGAACAGCTCTGCCCG
TGTCGTACGAACCCAAGCGGCCGTGTGATTTGTGATCGGATTGTAATGGCTCGCCTCTGTTCGTGCGCCGTGCCGATCGTTTCGAGGTCCTGGTCAGTGGAACAGTCGGCCCCGCAGGTT
GTGGCCGGAACATCTCGGTGCCTCGGAGGGGCCTTGGCTCATGTACAAGATAAGCCATGGCAAATTAATGGCCAAGTTGCTGATCGATCTTTTCAGAGGAAAAGAAGATGGCAGAGTTTG
CACAAGATGGGTCAGATTTCCCTCCTCAAAAAAGGAGTGATACTACTAAACAGAGCTGCACGCCATGTTTCATTTCGCAATCAGACGTGAACCAATCGAACATTTCTTTTGTCATGTGCA
TGTGGCTGTCCATCACAGTGCTTATCATGAACAAGGCTGGCGATGCGATAAGAACCGGATTTCCAGGTCGTTATCGGCATCACGCATCAGATAATAGCGCAGAGAACATAGGTGCCATCC
ATCCGCCCACCCGCCCGTTGTGCTTGCATGGTTATCTACATCTTCTTAGATATGGATCATGAAGGGACTAGTTGCCGATCGAGATCCTGGTAGGCCTAGGCCTTGGCCATTCAATTCAGT
ATCCAGGAATGGCATTTGGTTTCTGTTAGGCTTGTTGCAAGCACTGGGTAAACGAGCAGGATGAGGGCATGCTATCAGTTCTGAGTTCGGAGAAGAGATGAAAACATGGCCTCCGAATAA
CAAAGCAGACTGTAGGTTTATCGGCTGCAGGGGCAAATATCGACACACTGAACCCCAAGCCTAGAGAAGAAGCCATCTACATAGCCATTAGGCCAGGAAAACAGGCAATCAACGCAAAAA
CTAGCACCTGCATAAGACAGCCGTACGATGCAAAATCCAACTTGCACAAGAGCATGAAAGAACACAAATATTGAGACTAGATCAGAGAACGCGCAGGTAATCCGGAAACACATCCATCTC
ATGTGTAACACCATCATAATTCAGGGATTGTGTTCGCAACTTTCATATTCCTCAGCCTTTCAGGACAGAACAGTCATGGCTCATAGGCTCAGATTGTAGAGAACTATGCCATCTGAGTTG
CTTACACTAGATCATAGCCCTTACTTTGTCCAGAGCTTGAGAAGAAGACATGGGCAATATCTTCCCCGTCTTACATGTATGTACTGAAACGTCAGCATGGGCAACTCAGAGAAGTGTCAT
GTGCCCCCAAATGCATATTCACTGAACAAATGAACTAAGGCTAGTCTGCTACAGGTGGAGAGAAGAATATTTGATTAGTAGATTGGCGCTGTGTCCAACTCGAATGACGAGCGTGACTTG
CATTGCAATCTCAGACCAGGGAACACCAAGCGAAAAGCACCGCCAGTGTGACAAGGACCGGGATGTGCGTAGCATGAGCATGCATCCTGGTTGCGCCGGAATGTGTTGGAGCTGTGCTGC
TGTTTGATCTGGCGGGAGGCAGGGGCGGCTCCGCCACGTCCGAGTCTGTGAGGAGCGGCATGGGAGCCAATGCTGGTGGTTGCGCAAGTTTGCTGATGATTTGCATGAGATCGCCAGCAC
GAGGAGGGGCCATGAAAATCGGCGCGCTGTTGCCCATGTTCATGCAACTGTTCACTGCAAAATAGAACTCATCGTGTGAGTACAACAGATTGACAGCTGCAAGTATTGTGGATGCTTTGT
GATCTTAACACAGTACTATGCAAGACACACAACATGGCTAAGTGGCTAACTAAACTTACCCTTGTATCTTCGAGCTGTGGCAGGAAAATCAGTGATCAGCCCGTCCACTCCCGCGCCCTT
AACATACGCATTGATCTGCACTGTCGCATCTGCGAAGAAGTCGTATGGCTGAGACACAAACTCATTCATGAGAGTGTAAACATAGACCGAGAGACCCGCAGTCTGCAGTGTCTGGACAAG
ATTGGTCTTGTACATTGTGAAATGGTGGGGTTCAGGGAAAACAGAGCTGGTATCAACGGATACGGCACTAGCAAACTTTTTGATGTCCACGAGGGAAGAAGGTGTGGCATCCCTGACTTC
TTCGTTGATCATGTACACAAGATCGTACTTTGTTTGCTGCTTGAACTTCTCTAGAACTGAACTATTCGTCGACTGAATCATAACTTTCTGGGTAGTTTGATTGTTGTAACCAGCATCGCC
AAGGGCTTTGATAACTGTATCAACCATGTCAAATCCAAGTTCCTCTGCCACAAAAGTGGCATGCTGCAAAATATGAACATCAAGTTAATTGAGGGCATGAATCTACTACTGGAAGTCAGG
GACAATTTACATTTTTATGGGTTTTGTCTTCATTGATGTGCTTTAAGTACTACAGTATGAAATAAATGCTAAGCTCTTGACAGAACCAATTAATGATTCAACAAAAGTGATAGGGGCAGC
CAAATAGCCAGTATCATAGTAGTAAATAAGTGGATTTTGTTCTCTTCATGCACTTAAAGACTCACTATTAGCATGAATTCTCACCTCTATACTGATCATGATTCCTGATAAATCCTTATT
CTTTGTGAAGTCCAAAAAGTCTGATAGTCTCATGAACTTTCCTGCATTCCTGTACCTCGGATTTCTATCCATTCTGTAGGTGGATAATGGGGTAGATATTATGGCTGTAAAGATGGAGAA
AAGTTATCTCAGAATGCAGGCTTGATGCCAATGGCACAAACACAATAGCAGAGCAATAAAGCTGTCTAGCTGGTAGCTGGTCAACAAAATATATAAGTAGGCAATGAAAGATGATCCAGA
TCAGATAGCAGGTGACTTGATGAAGCAAAATAGCCAAGAAATATATAAATGATTTTGCACTTCATTCAATAGCAGAACCATTTCAATTCAACTTACGTCTCAGATTCTTTACAATGTCAT
CCCAAGTGAGGTTGAACGTAAAGACTCCTCGCGCACTCTGAATTTCTTTGATCACTGCCGTCTGAGAGGCAAATTGCGATCTTGCAACAGTAGTATCATCCATTAGATTAACTGAACTCA
TGCATACTAGCACTCCATCTTTGGTCACTTGGACAGGGCAATCAATGACATCTGCGCCATCATCAACTGCTTTTTGATAAGCTAGATCAGTGCAACCGGGGTAGTCCCCACTAGCACCAT
TGTGGGAAATAATAAGAGGTTTTCCTACATTCCAAAAGTGAGAAACTGGTGACTGGCAACAAATAAACATGAATCATAAAATAATACGAACAAAGGATCTACACATACCATGATCTGTGT
TGCTTTTGTTTAAATTGGTAAAACACCCTGCACAACAAGATATAAACACTGTGGATGAGAACCAATAATCTTTATGTATCTTCAGATAAATCATATGAAGACAGAAAAAGTTCAAAATAT
GGCGATAAAGGCAGAAAAGCGTACTAGATGTTTGTGGCAAATGCTCTTTGCTTTATATGGAGAATTAACAACAATGTCATAGGAGTTTTAGATATTAATTCTCTCTCGATTTGTTAGTTT
TCCTGCATATAAGTTAGAGATAAGATCTTATAGTTACCTGCTGTATGCCTGTATCTATCCTAATGACTTGTTGAATTTTCTTGGGTACCAAGTTACATAGTTTGAGTTAAGGTTTATTAG
GGCAATTAGCTAGATCTGTTCAGAACCTCTTGGCTTCAGCTGGTGCAAATCCAGCGGAAGGGCAATTTCACAGCCATCCAGTCCTCAGAATACAGAAACCAGTAAGGAACTACATGCCAC
AAAGCAGGAAACATGGAATATTTGAAAAGCAATCCACTATATCAGATATTTTGAACAATGATTTAAGGAAACGTGAAATCAAAAGAGAATATCAAGATCTATTCCATGGTGTGCTAAGAA
AACAGTGAGATTATGCAGTTTGGAGATTTGTTTGGTGAGTTCCTTCAGGAACAGAGAACCACTTTCTCAATTAAATATTGGAGTTATATATATCAGTAGCTATAAATCTATTAGATAAAA
CCCAGATTCTGTCAATAAATTTGTGGTTTAACCCAAATTAATTGACTTAGAAGCCTGATCCCCTGCTTTCTTCCCTCAGAAAATAAAATGGTAGAAAATTTTGAAGAACAAAATTGTGCT
GATGTAAAAATAAACTTGTCGAAAGAATTAGGACTCACCAATTGCCTCTGATGGTGTAACAGGGAAATCAGTCAGTACACCATCAACAGAGAACACACCATTATCAATGAACGTCAGACA
TTCTGCTAAGGGATCGTAGCTGTAGTTGTAACTGATCATAAAGTCATTTGCAAAATCAGCGGCATAAATTTCCAACCCAGCTTTATGAGCATCATTGACAACTGAAGTGTGCGGCTGCAG
ATAATTATCTGCCGAAGTAGGCCAAATATAGCTCTTTGGGACAAGTATCCCGGATGCAAATGTCTTGACAAATGTAAGATTCTTCAACATGGAACCATACGTCTGGTTCATAGATGGTTC
GAGAGTGCTCTCATCAAGATAGCGGAACACAAGCTTTGTCTTTTTGCTAACTCTTCCAAGTACGCTGGTGAGGAAGCTCACTTCAGGTGATGAGATATAATTGACAACAACACGCTTAGA
TACAGAAATGATATAATTCCTCATGCTTAGATTGAACTGGCTGTAAAACCTGTCATGCTGCAAATGGCATTATTTCAAGGTTACAGCGTGACAGCAGAAAACAGTCCAATGTGACCTACT
ATATGGAATTATATTCTTCAGTTGTACCTGAACATTGAGCCAAATTCCAGGAGGTTTGAATTTGGACCGCACATCTTCGACAGCAAGTGGTGGATAGAAATTTGAATCAAATCTGGGTGA
CCGGGAAGCGATTGACTGGATGACTGCATGGCATATATATCGCGATGAGTTAGATGAGTAAACGAATCATGTTGCTCAGATCATAGAAAGTTCAAAGCAAGAGGCATTTCCCCTTTCCTT
TCACGAACGTGCCTAGGCACGTTTTTCATTAAAAGGGGAAGAGGCATTTCCCATTTCTTCATCTAATACTAACATGGCTACAGGCATTAACAACATCCAACATTTAGTGAGATAACTTAG
ACAGTATGATATCACTTACGAGACACTTGTCCAAGCTCAGTGTTATTGTAGTCTACAGAGAACCATCCTGATGTAGGCACGCCATTGACAAGGTAGCTCTTCTGACCCTGTGCATAGATA
TCTGCAATATTTGTGCAGTTGTCCATCTTTATGTCCGGCAGGCACAAGCCAACCTCATCCTTGGTTAGCCGAACATCACAGTATAGCACTGTATCCGGCGAGCTAGAATACTGCACAAAT
CCATAAGCATCTGGGCTTGAATCAGGGAACAGCCCTGAAAATCCACCCTTGGCTACGATTGCTGGAGCCTTGCCTGAAAAAACAGGCGTATTTGTTAGCCAAGGGGATGCCTGAAATGGT
TGTTGGATCCTTAAATCTTTTCATCCGGAATGCATTCGAGAAGCAGGATTCTTATGCAAAATGAGGCATGCAGGTAGGATAAATCGTCAAGGAGACCAGGCTATATGTTTTGCTGTAACG
ATAAGAAATGTATAAGTGTACAGAGATACTATCAACGCACAGTCATGTACCAATCCTTCATCTCAAAAGCTGCTGCCAGGTCCTAAATGATAACACAACCATCAGCTGGAAGACTAGGCT
ACCAGAGGGGGAAGGACATCTTGATCAGTCCAAAACAACCCCCGGACGACCCAAAATCTAAAACCCTTAGCAGATTGTAGGAATTTCACGCAATGCTCGAATGGATGATAATCGAAAGAA
CAGGGCTAAAAGCAAAACAGACGTGCGCAAAAGAGGAATTTTGAGCAAAAATGAACTGGCGGCGTCCAAAAGGGTCATCAATCCTGAAGGAAAAGAAGAGGAGAATGGGGGATGTGTACC
GCTCAATGTCTTCCAAGAAGTGGCCTTCTGCGCGGCGGCGACGCCCAGCCACAGCAGCATGAGCTGCGCGAGAACGGAACAGACATGGCAGGCCCTCATCTCCTCCGGCAGAGAGCGCCG
CCCTCGGCGCAAGCACACAACTCCGTAAAAGAGCGGTCTGGACCGGAAATGCCGCCCCAAGGAGGCCAAGGAGGCAGCAAGAATCGAGAAATCCTTGAGCCGCAATGGCTATGTTGGATT
TTGAGCCCCGAGACCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNTACTCCGTGTACTCGGGGAGTCGGGGGGAGTAGAGTAGTAGTGGTGGTCAAATAATGAGGAGAACAGCTGCCTCCAGCCTCCATTGATGGCTTCAG
GGTCAGGATCAGGGCTGGTCGATCGTTTTGGGGATTCTTCAGGATCAGGACTGCTCGATCGATATGGGGGTGGCTTTACCCCTTTCTTCTCTCTGCAAGAATTTTGTGGATGCTGCTTGG
TTAGTGACGCAAGTTAGGCAATAGCACTGTTTCTTTCACATTTCTTGCGAAAGATGTGGCATCCATATTCTACGCCACACTTGTGGCGGTGCCAGGGATGGAGCGTGGCCGGCGGTGGCC
GGCAAGCAAACAGCAAAACCTCCAAACGTCCACAGATTGGCAACCATATCTCCGTGAGAACGATGGTGCCATCTAAGACTTGGTTGGCGATGAGTACATTACTATCTTATTGTGACTTCA
CGTACGCGTGATAATTATTTCTCTTGTAAGAATAATAATACTATCTAAGACATAGCAGGCGACAAATACATCATCATCCTATTATGGCTCCACGTACGAGAGTCAGTATATTTAGCTTAA
GTCAGTCTTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTAGTGGAACTTCTGCGTCAAACCTAGCTCAAATAACCTTCCGACCTAGGAGGCCGTTCGTGCTCGCTCATTAGCACCACCATTTCCTCGT
CGTTTATGTATAAGAGACTGAGATTACGATCTCGGTCGCTAGCTAGTGCTCTAATCGCGTACTTGCATTTCAGTAATGTTAGCATTTACTATGCTTGCCGAAAGGAACACGAGTCATGAC
GCAAAAGTGTAAAGTTGTTTGGGTGGTTAAAGAAATCATGGCCGAACTAAACCTTGCTACAAGTACGGATCACCCGTGTTTTGGCAAAGCACCGTGGCGGGCGAACCAGCGGTGCGAACT
TCCTGCCGCGGTTGTTTCGGCCAGCTTTCGCACTGGCGATGCTAGGTACGAGTAGGGTAAGCATCCAAAGCCAGGTGAGCACGATGATGACGTAAGCGGTAACAGTAGCCGGACGGCTGG
GCCTGGACCCGCGGCTCGCTGATTCAGGCTGACACAAGGGTGTCCTCGCGGAATAACGCCTAGGTGCAGTGCCGCGCAGGCCGACCAGGGCCTCACGCGCCCCAAGCTGACTGGCAGGCA
GGCCGGTGGCTGCGCCCACCCAGGCAGGCTATCACCCGATCGGTGCGCCGCGCCCGCCTGCTCAACGCCGGGACGGCGGCAAAAGGAAAGGAAGGAAGGGTCCAACTGTCCAAGACTCCA
AGGACAAGGAGCCGTGCGCGCGGGCCGTCGGTCCCGGCCTCCCGGGCGAGACGGCTCCGTCGGCTCTGGCGTTTTCCAAGACACGGGCTCCATGCGGGGAAAGTCGCGAGACTGGCCTCG
CCCGCGGCATGCCCGGATCGCGTCGGGATTCGACGGGATCTGGTTGCGGGATCTGGATCGCGAGGCACGTTTGGTTAGCACACGTCGCTACCGAGGAGCACATGCATTTGCAGCGTGTAC
CGAGAACGACTGGACCTCGCGCCCTGCCTTACCCATGGCCGCGCGCAGCACCGGCTCATGGTCTCACGTCGCCGCCAGCTTGACGAGCGAAAATCCCTTCCGGAGGTTGCCTACCTCGGA
GGGCATTTCAAACTGCGGTGGATTCCGAAATCAACGGAGCGAGGACAGGCGAGAGGTTATCAGAAAGAGGTTATCACGTCTCCTTCTCTCTTATTATTTTTTTATCTATATCCATCATCC
GTCTCCTCTGTCTACATTCCCGATGCTCTCTCTCCTCTCTCACATATCCTCTCTCTCTCATGCCAACAAGAGAAGTTGAGAGGAAGCGGAGGTGACAAGAAATGAGCGGCCGGCGATGGC
GGTGCCTGGCGGCGCAGGCTTGCTGCGCGTGAAGGAGAGGCTGGGAGGAGAGGGGATCTGCAGGCTCCCTAGGCAGCGAGCTCCAACATGGTGGAGGCAGCGCACCCCAGCGGATCCCGG
CGATGACTTGTGCCCTCACCGGATCTAGCGGGTCCATGGGGCTTCACTGACCTTTGTTGTAGGATCCATGGAGGAGCTCGACATTCATCACCATAACCGTGGAGGCGGCTGCATCGAGAC
TGCCATTCCCGAGATCCCCTCCACCATTGTGAAGGAGGATGCCCGATCTGTGGATGAGGAGGCTAGATTCGGCGGCTCCACATGCAAGGTTGCTCATAACGGATCTCATCTTCAGTTCTC
CACCTCCTTCATGCCAGGTTGATTCGCCTTCTCCTCATTCCCTTTGATTGCATCTCAGTCTTGAATGGTGTTGAATGGTGAATCTTCCTGTTGCTTCCATTCCTTTCGCTCAGATGTGGA
TCTCACATTTCCGTTTATTTTAAATTTTGAGTAGATTGGAAAGAATGGACCGGCAACAAGCGCGGCATTTGATTTTCCTTTTTTTTTCTTCACAAAGGTGCATGGAGCTTGCCAATATTG
CATTTTTCATCAACCAAGTAGCCATCATGCATTTCATCTGTTGCTTTCCTTTCTTTTTTTCCTTTATGTTTTCCAACCAGGAACAGTGCTAACAATCATGTATTCCATTTTGCAGTGTGA
GTTTTGTGGTGTCGGATTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTCTGCCCAGGTGCGCCTCTGAACCAAT
ACCCGAGCGGGTTAAGGAGGGATTTTGCTGGTAGGAGCGGCTGATCATGCTCTGCTCGGCGTCAGTAGCATTCACGAGCAATCATACAACAATTTTTTTTCCTCGACGCAAATTTTTACT
CGACCTGTGTCCGTGTCCCACATTTTTACTCGATGCAAATCCACCATAATTTTTTTCATTTCATCAACCAGTAACAGACCAACCAACAAGGTGAGCAATCAGACAACTTTTTTGACAGTT
GGATACTCCCAGTTCAACCAACATGGTGAGCAATCAGACAATTTTATCACACAGCATACTCCCAGTTCCATGAGTCCAAACTCCAAAGTAATTGATAAATGTACTGTCAAGCAGTCAACT
ACATGATACATGAATGGTGAAAACCTTGCGGTGTCCAGTAAAGCTAACGAGAGGTGGGAGGAGCAGACCAATCAGACAACTCAAATAAAAGCATACAACTCAAGGGGAAACTCAAGTACT
TCTACTTCTTTGCTGCTGAATTCTTTTTGATCTTGGTGGCCAGCTGTTTCTTCCTTGGTGTCATCTTCTTGGCCACATTGGTTGCTTGCTCCAGTGGTGCCTCCAAAGCTAGCCTCCTGG
ACAAATAGCAAAAGAGATGGAACATCATGTTTAATCCATGGCTGGAAATGACATAGAAAGGGAAAAAAACAAATGCAAGAATATAAGTCTTTAACGGTTGTACAGGTGCAAGAATATAAG
GTTTTAGTAGTATTTCAACGTATATGCTACTTCATATCCTACACAAACAGCACAAGGATGCGTCAAATGGAACACATATGTGACATGTGTGACAAATATCACCTCTTAGTGGATTGTATT
GATGTTGATGCTTCTGCTTCATTGGCTTTTGCTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAATACTATGACTACCATAGAACTCTACATTC
ATGGAGAGGGAGATGATTCACTTACCAAGGAGGGCACTCACTGGGTGTCATCTTCAGGTAGCGGTGCCGCCTTAGCTAGGGTTCCAGATCGGTGCCACCACAGAGGACATCGTCCCCTCC
ATGCTAATCCCCTCCGCTGCAATGCAAATCCAGCCACGAGCACACTACACGCACGCACAAACCAGGTTAGGAACCGAAGCACAACAGCCCACCTGCTCCTCAAAGCGGAACAACGGATCA
GAGCCGACAAAGAGAGGAGTGACGGCACAGAGAGGGTTGAGCGTGGGCGCGCGCGGTGGGGTATCGCTGGTGGGCCCCAAGGGAGCGGCGATGGTGTTGGGTGCTCACTGGGTGGTGGCG
CACGGAGAGGGTCGAGGATGAGCGCGCGCGATGGGGAATCGCCAGTGGGCTCCCAAGGCAGAGGCGGCGGCGTCGGGTGCTCACTGGGCGGCGGCGCCGGAGGGAAACGATCGGTGGCGG
CGTAGGGATCCCAGCGGCACACGAAGGCCATGATCCCCTTTGTGCACAGGAATAGGGAACCCACTCGGTTGCTGGTTCAGAGCGCGCCTGGGTAGAANNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCATCGGATTTGAATGGAGAAGGATTCGCGCTGCAACGTTCCAATTCTTGTGTAGAGATGACAAAATTTGCAA
TCTATTTTTCGTATGGCACTGCATATATAACAATTTGTAATGTGTTTGAATTTTTTTTGTAAGATCTAACTTGTGCGTGAATTCATATGATCAGAAAAATAGGTAATTTTTTGGTGTGTT
ATTTTTTAAAACATCTACCTTCATGTAACAATTGGTGCGATGATATTTTTGTAAATGTTCCATCGTCCTGCCAGNNNNNNNNNNNNNNNNNNNNNNNNNNNGTTGTCGGTGTTTCGCATC
GCCACCAGTGATTGTACACCGCGCTCTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGCAGGAGTCACGGTGCTTCCAAG
CAAGCGTTCGTGCAATGTGTGGGTATATGCATTGAATAAGAGAGAGAGAGAGAGAAAGGAGGCCCGGTTCAAGGCTAGAGACCAGGTAACAACGTTGGAAAATGGAGGTGGTCCCCATCC
TCAAAGGTCGGGGGTTATGGTGTGGTCGGATCTTCCTTTCACCAAGAGGCCTCCTTGTCCTATCCCCTTGGCTGGTCGTGAACTTCGCACATCTTGTACAATGGCTCCTGTACGGCGTGG
GTTGCTTACCACAGCCTGACCTGCTCCATGGCGTGCTCCCGTCCCGTCCGCCAACTCCGTAGTAGTGAATGGGACGGGTGATGTTGCTGTCGTCCATACTGGTGATGAACAGGCAGGCTG
TGATTAGTGGCGTGGACGGGGGGCGCTCCTCATCCCAGCTTTCCCCAACCTCCCAACCTCTTTAGTACGCTCATGACCGCTTCGTGCTGTAACGCCTGTCACTGGGTCCCACCTCGCCTG
CGGGATCGTAATGGGCCTAGCACGGTGGCATGGCCTCCTCGACGGCGAAGGCGATGATGACGCTGGGGAATGTGGGCGCGTATGGCCACGTGTGGCCTCATCCTGCAGGCCATCCTGGGC
GGTCCAAAGGGTGTAGCCTCACCCTCGGACCAACTGTTTAAAGGTCGGCTCCCCTCCCTCGGTCATGTCTCCGGCATGGGGCGGTCAGGGGGGCCACGCCATGCATTTAATGCCTCTCGT
ACGGCACAGGTCTTCATGAAGCAAGGAGTGGGTGAGGCGTTGTGGGCCCCTTGCAGGCCCCGTCCCCGAGCTCCAACGAGTCGTGGCTCTTGTATTCCGACAAGGGAGGTTGGGCGGTGG
GCCGCAACGTCATCTGGGCCGCTTCCAAGATGCTTATAACTGTTTGGCCTTTGGCCTTTTGGCACCTTATTGCCTTAGCCTCTTTCTTGAGGCTACCCGTCATATGTGCTTGTGAGGATT
TTCAATATTTCATGGGCAATATTTTCCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTCACGACACAGTGTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCACGCAGCAATAGCATCCACGATCAGGCATGAATGATTTCATCTATGGAGGCTGTGAGCCTG
CTGTCAGGCAGACGTGAGGCTCGATCAGGCATGAATGATTTCATCTATGGATTTCATCTATTGCTTTGAGAACCGCGGTACTTTATAATTTGCTTGGAATGCTAAATTGTTTAGAAAAAT
GGAACATTATCTCTTAAAAGTTTCAAGCACTGTTAGTAGCACATTCCCTCAAGTTCTATGACGGGATCTGGGCACTGGGCAGAGGAATGGCGGGGAGGTGACGGGCTGACGGGTGATGGA
CTAGGAGCTGGCGGCGGGCACGGACGCGAGCGGAGGGCAAGGAGGCGGGCGATGGAGGCCACAGAGGTGGCAGCCGCAGACGGACGCACGGGAACGCNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNCGCCCCACATCTTTTGACATCTTGTGCGCGCAGAAGTCCGGTACCTTGGTCCACATGTTATTTTATATTTAAAAATCAGTCATTAACTTGGTAACTACTCCTAACACAAATCTCG
AAGCGAAAATCTGATGGGTGTTGTAATGCCCGCCCCGGCATACCAGCATCGAATTGCCTTGTCCCTCGACGAGTGGCTGGCGGCGACGTGAGACCGGTACAGCCTGTCGGTGGGTTGCCG
GACTCATGGTGCAGTCATACTCCGACCCCTTTTCTTCAGTATGCGACACGTCTTTGAAGATTTGAGCATTTTCTGACGATGAATTGAATTCTCGCAAAGAAAAAAGAATGGACCAACGGT
AGCGCTATCTCATGACCAATGCAAGCGGCTGGCTTGCCCCTCTCGTGGTTTTCCCCATGCTATATATGCACGTCGCTTTCCTCCTCTTTCTAACCTGCTCGATCGATCGATCGTTCTCTC
CCTCAACCACCACTTAAAGCCCGAACCTTCTGCTACAAACGTGTTTCTCCAGCCGTTGTACATTCTGCTCTTCGTCACGAGGCGAGCCTGCGAAATCGGCCACCATATCGCTTGCTCCGA
TCTCCTCCATGTGTGGTTCTGCACCATTGTGAGATAAGCACGATGTCAAACCAAAGAATGGAATTGCCAAAAACTAAGTAGCAAGTACCTAACTCTATGTTCAAATTCCAAGTTGTTCCA
ATTCAATTAAATTTTTTCAGTCTGAAGAGCAGCAGTACATACACACCACACAGTAAAGGCGCGTTGGACCCGCTCTAGCTTTGAGGATCTGTCTAGCACAAACGAAGAGTCCAAAAGTTC
AGACCAACGCACAAATGTTCCAGCAGTACACCTGACAGCGGCACAAATGTTCTTGCACATACTGCGTCCCCAGGTCGGGCTATCACGGAACTTGGACGCGCTAACAAAATCATTAGGTCC
GGGTACAGTGGCGGTGCGCGATCGAGGTGGCGCGAGAGATTGCTTGCCAGTGGATCGCAGGGCCGTCCTGTATCTATAATTCTATATGCTTTTGATCCAGCCATGGTCGACCGGCGTCCT
CCTCTGCTCAAATGGATGGTACGTGCCATGCTGGGAACGTTGTCTCCCGAAAAATTAGCAGGGCCTTTTTGTATCTGTAAGTCTATATTTTAGGCCAAACGGTTAGTGTTTTGTTTGTGA
CCAGGCCAAAGTTGAGATAGTAATAAAGTCGTGGGCCCCGAAAAAAATGGTACTAGTACTACATTAGTATCTTACTTATCATTCTTGAAGTTAGATCTCTTGAAACTGTGAGTCACTGGA
CAAGTGATGCTCACATATTGTCAACTTTTCTTTTACTGATGATCACAAAAGTGCAAAGTGTTGAAGCAGCGAACCACAGGACACCCAAGTCAGCGCGGCAGCTGGTGCATCAACCAACCC
AAGATCGAGGGCCGTTTTGTTTTGCTCCCCCAAACAGTGTCGGCAACCTCTGTGGCTTTGTTGGCTGTGTAGTCTAGAGTAGACCGCAAAAGCATGGCAAAAGTTTGGCCTCAAACTCAA
AGCAGAACCGCGCGGTGGTAGAGGATGATTCGCCGGCACGTGTAGCTTAGGAATCAGGACCCCACCTGCCGCGAAAAGCCTGGGCACCAGCGCTTTAGGAATCTTCTCTCAGTGCAGAGG
AAGAGGACATGGAAAGCTGAATAAATCTCAAAGCGCCTTTCCAGGATAGGTTGATGCTTCACCCAATCGCCTGCCTCTTTGTTTGATGGTGCTTCTCCCTTGTCTCTGGTTCGTTCATGC
ACGCACAACGCCTGCATTGTTTGTGACATGTCGTGCAACACACATCGTTCATCAACACTGGGAGATGTATGAATAACGATCTGCGTTCACCAGAGACCACAAAAGCTTGAAGCTTGCACT
TGTAGTAATATGCTCAACAGTCGACACGTCTCTATAACTCTTTCTGGCTGGGAAAGAAAGAAAAAGGAAACGGGTTATGCTGATTTGTTAAACTAGGTCTAGCTAAACTGGGTCTGGCTG
GCCTCCCGGCGGATTTGAAGGGCACGTTTGGTAGCCTGGGCTGCCTCAGCCGAGCCCGTGAGTCAAGCTCCACAGGTCAGGTTCATGGGATGCAGAGATGTTGATTAGCAAATCTATACC
CCATGGTGCTAGTTAGGCTGGGAGGGTGTTTGGTAGGGTGGGCTGGCAGTGGGCCCCCTTAACTAACCTAAACTGCCATCAAAAGATGGTGTTTGGTAGCCTGCACAGGGGAGAGTTGCC
CTCACCATGTGCAATCGTTGGTGAAGGTTACCCCCCGCCTAGGCACCTAGAAATGCACAGATCAAAGGATTTTGAATTAAACTGACTTAATAAACAAGTAATTAGGGAGGTCAACTATAC
ACTTGTGAGCATAATTTTGGAGGAACGGAATTACATCGAGTTAACAAGGTAATTAGCAACCTAGTTAACATAATTAGGGGCTTCCTTGTATGAGAGTTGAAGTAAAGCCAAGTAGGAACA
TGGCACAGAGGGCAATAATCACTTGCAAATGCCGACATTGATGAAGAGAGCAAGTAGAACCACAATGATAGCAAATTTGAGATCAAAGAATGTCCACCGAGCCATTAATCTACAATGTTA
AGAAGTAATGGGTCAAGATTCAGAAAAAAAAAATAGCAACCAAGCTATCAGAAGTGCATGAAAACCAAGTCATCATCACCTCAAAATGGCTCAGCCTACAAATAAGCACAAGAACCATAG
AAGGTTCCCATGTGCCTTAGCAACAGGCAACATCTCCAAGCCTCCTTGCCAGCGAGTAAAAGCATCAACATGGGAAATAGAAATAAACTCAAGTTAAAATCAAGTAAAACTGAACAAAAA
CCTCAGACATAATCCATTTGGTTAGTCATCATTGGTTAAAAAATGAAGTATGGCTCAGATCAGGTGTAGTATTTGCCTAACAAATAGGATAGAGGCAGGAGTTGCCTCCTAGTGAGGCAA
TTAGAGAAATCCCTGACCGTAGGAGCTAACACCTACTAGGGTCCTAACGGGTGTGTTTGGTAGCCGATGTGGGCATCGTCATCACCATCGCCATCCACAGAAATAACACTACTGTAAAGC
AAATCAACAAGGCAGCAGCATAAGAGACAAGTGGGTTTTTATTTAGGCTCAGCTCAGGTGCAGATGCATGTGCCAAGGAGGTACCTAATAGTGAGGCAATCAAGGCAAGGTATACCTTGT
TTGCCTCAGTACGTAGGCAGCATCTTGCGGCATGCATGCTACCACCTTTACATCATCGCCAATAGGAACATAGAGGCATCAGAGAGGGTTGCTTGTGCCATATTGAGAGGGCCTACTCGC
CAAGCTCAAGTGGATGTTGGTCAAGTCACCATAAGGCAACTTGACCAAGGTCCACATCGAGCTTGGGGAATATAACCTACCAAATATAGTCGCAAGTCTGTTATTGTCCGCATACATTAC
AGTAAAACCTTAAGAGCAAATACAAAAAAAATAGAAGCCTCACCATAATGAAAGCATTTGCTTCACCAATTTGATATCCTACCTCAAACACTTGCATTCAAACAACTGTAGTTTGATCAC
AAAAAGCGACAAGGTGAGATTCGCATCTAGCTGGGTCAGAGCACAAAAATTTAGGCTCATCATTCCCAAACAAGCAGACATAACAAAAAAAGCAGCCAACATAAAATTGCCTCAATACAA
GTGCATCACAGGCATGGAAAGAAGTATGTTGGGCCTCAGATTAGAAAGTAAATCTCCACCTAATGTCATACAGACAGGTGGACTCAAAAGTGGCAGGAAAAGAGCAGAAAGCAAGAGTAG
AACAGAGGCAATAAAACTTACACCAAACAAAGAACAGCATGAAGAACAACCAGAATAGAAGTGTCACTTCATCATTGTCCTACCCATTACAAATCATCACAGGCCAAAGAACATGAAAAC
AACAGCAGGAAAAAAGTAACAATTGAAACATGTCAACAAGTTCATCAAGTTAAAGAACAACAAATTAAACATGGTAGCAAATTAAACATCATCATAAAGAATAGCAAATTAAACAGCAGG
TTAAGGAACAACAAATCAAACATGATAGCAAATTAAACAGCATCTTAAAGAACAATAAATTAAACAGTAAGTTAAAAAACAGCAGGAACATGCTAGCATATGAAACAAAAATAACAAGTT
AAAGCAGAGCAGAAACAAGTCAACATGGTAACAAATTAGGTAAAGTAAATAGAATATCATCTAAAAAGGCATACATGGCATCACATCACAAGCATTGAAGGTATATAGTAGTACTAGATC
CATCATATTACAATACTTACTTACCATGCGGTTCCTTAGCAAATAGTTAGTAGCAATGTTCTTAACCTTGCCATGCTGCCATAGAACTTAATTAGTAATTAGCCACCCCCAATGTGAAAC
CAAAAACCACCACAAAAGGTCAGGTGCAAGTGAGGCTACACACTAACAGGTCAGACCTAACAGATCTACTCGGTGACGAAGACGAAGGACGGATCCAATGTTCGCTGTTGATGGAGACCC
GACGCTTGCTGGTGAAGATGTACCCGCGCTCGCCGAGGATGAAGACCATCCGCCCGTTGGTGACGACGACCACGGACGCCTCCAGATCAGGCGCCCTGCCACCAGCCGCGTCGTCGCCTT
CGCCATAACTCGCCGGGTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCGCAAGTGGAGGCGGCACGTCCGGGGGAGGAGAGGTGAGGC
GGCCGGGAACCCCCGCTATTATATCGACAGGAGGTAAGCCTAGCCAGCCAAAAACTTACGTGAAGGCCCGCTCAGTCTCGCGCATTCCCTCCACGTACGCGAAAAGACGCCTGCGCAAGC
CTGCATCGTGTGAAACGGCCGAAATTGACGTTCCACGCGGTGCAACCTGGCGGGCCGTTTATGCAGCCGGCGGGCCTGACCTGTGACCCCCTCCGGCCTACCAAACAAGGCCGGTTGCAC
CCCGCGGGCCTGGCTAAATGCCCATGCGGCCTGCCAAACGCCCCCGAATTGAACGAAGCCTGCGCTGTGACGTGGGCCAAAAAAAAAACGCCTGGTGCAGCTTCCCTCTCTGTTCGGCGG
CCTGTGGGAGCCCGCAGACAGCCAGCCAGCATACTCCATTTTCGTGGATGGGTGACGATGACGACGTGGTGGCAGCCGTGCACGTCGCCATGTCAACCGCTCTCTGTACTTGCTGATCTG
ATGATTTTATCAGCCGTGACAAGCACAAGCTAATCATAGCATATTAATATCGTGCTTTAGTCACCTGTTGTACTCCGTCAATGGGGATTCGATTTGTTTTATCATCGGTATCGGTTTCAC
GCTCCTTTTAAACAAAACCAGCGCTTCCTGTCGGTGCATATTGACATTACGAGCTTAATTCTTTCTCTACTGGTATGCGAATCATTTTAAGTACTAACGTCTTGTTTGAAAATGTTCTCA
AGTTACAGCTTTTGTCCCTACAAACCACACAATTATTTGGCCTCTCAATGATTCGATATACGTGCTTCAAACTAAACCCGAATTCACGATACGGGTACAGAACCGCACATCAGAGGAGAC
GTTGGTCGCCACCACCGTCAGAAAGAAAAAAAAACATTCCCAAAATCGTACGATCCTGTACAGTTTCTTCGGTTGACCACTTGACAATGGCAGCATAACACTGCCCACCCCTACCGTCTA
CCGACACGCTGACAACCAGATGCCAGCCCCAGTACTTTACTCTCACCGTTTCTTACGCGTCAGCAACTCAGCATCCACTACAAATCCTCCTCCGATCAGTTCACGGCCTCGCCACGGCCT
GAGCTTTCATCTTGATCAAACTCCTCGCGGCTGCACTTGCAGAGAGCTGCAGCGTTTGGAAGAAATGGACCTCAGACCAGCCGTCCTTGCCATCGCGATGCTCTGCCTCGCGCTGCCCCG
GGCGGCATTGTCCCAGTCCCAGAACGCACCGCCGGTCGCCGACACCCCGGCGCCGGCCCCGGCACCGCACCACGTTAACCTCACCGACCTGCTCTCGCTGGCCGGCCCCTACGGTACGTT
CCTCGGCTACCTCGTCCGGACCGACGCGATCCGGACGCTCCAGAGCCAGGCCAACGCCACCGAAGGCGAGGGCGTCACCGTGTTCGCGCCCGAGGACTCGGCGTTCGCGGCCGTCGACGG
CGCCGCGCTGTCCAACCTCACCACCGACCAGCTCCGGGCGCTCGTGCTGTGCCACGCGGCGCCCCGGTACCTGCCGCTCTCGTCGTTCGCGGCGCTGGCCGCGTCGGGCCCCGTGGCCAC
GTTTGGCGGGGCACGGTGCGCGGTGAACGTCACCTACGCCGCGGGCAGGATCCGTCTCGCGGCGGGATGGACCAGGGCGGCCAGGCTCGTCAGCAGCGTGTACTCGACGCCGCCGGTCGC
CGTGTACGCGCTGGACAGGGTGCTGCTGCCCGAGCAGGTGTTCCCGACCGANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGCGCGAGGGCGATGCGTCTGC
GACCGGCGGCGCGCCGGCCGCCACCGAGCATGGAGGTGACAAGAGCTTGTCGTTCCGGGTCGGTGCAGGTCGCGTTCTTGTTGGCTACTTGGCCATCTTTGCCTTCGGGTTTCTGATGAT
GTAAACGTCGATTTCGATCTTTTGCGTTGGTGCCGCACGTACGGTGAAACTTTGTCGTAGTTTTGTAAGAGGGAGTGGGTTCTGTTGCACCTTGCTCGTGTGTTATTGCAGACGTGTCGA
TTCGTTTGTATTGTACCGTGACGATTTCCACAGGTTAATAAAAGAGGACTCTTACACGACTCATCTGGTTCTCCACAGCTGCGTGTCTGAACTCTCAAGACGATCGTTTGGCAGTTGACA
CAGTCCTGCAGTGTCCTCTGAGCCACTGGAAAAATAGGAAACGAGAGCTGACAGCTCGCACAAAGATCGCATCTCGGCGTCTCCCTGTCTGTGCAGTCGCAAATAGCCGGCAGTTGTTCA
CGCCGAACTCCGTCGCTCCGGTCTTCCCTACGACACCGCGATCTTTCGCGACATGTTGAGGTGCGCCGTCGCGTTGCTCGCGACCGTGATGTCCGTGTCCGTCCTGCACCACGCCGGGGC
GCACCGGTCGCTTGCCGTCAGGTTGCCCCCGGCGACGACGCTGCAGAGGACCGACACATGGCCGCCGACTCCTCAGGCCAAGCGCGCCAACCTCACCGCGATCCTCACCCTCGACGGGCC
GTTCCGCACCTTCCTCGGGTACCTGCAGCAGACCAACCTCGTGGAGGTGTTCCAGAACCAGGCGTACCGGACTGACCAGGGCATCACCGTCTTCGTCCCCGTCGACAGGGCCTTCGCCGC
CGTCAAGCCGTCGGTAACGTCGAGAACCATCTCAGAGTATTCGTGTAGAATGCATGCGGAGCAAGGGTACGTGATGACATCATCAGGATTCGTGTGTTGAACAATGATGCAGGTGCTGTC
GGGTCTGTCCAGGCACCAGCTCAAGGACCTGATGATGTGCCACTCGCTCGCCAAGCACTACGAGCTCGCGGACTTCGAGGGGCTGAGCCGGATCGGGCCGGTGACGACGCTCGCCGGCGG
TCTGTACACGGTGAACGTGACCTACGACGCGGGCACCGTCCACGTGCGGTCCAGGTGGGCCGACGCCAAGGTCGTCGGGAGCGTGTCCGTGGACGCGCCCATGGCGATTTACGAGCTCGA
CCGGGTGCTGCTCCCGGACTCGCTCTTCCGCGCCCAGCCGCCGGTCGCGGCCATCCCGGACGTGCCGCCGGCGCCTCCTCCGACCAAGGAGGACGCCGAGGCGCCTGCGACTGAACCGGA
TCCCGTCGCGCCGATGCAATACGATCCGGCGGGAGCGGCGGACGCCGCGACCTCGGCGTGCGGAGCCCGCGATCGGTTCGCGCGCCATGCGGCCACCGCGGCTCTCGGTGCAATGGCGCT
GGTCGCGTTGTGATCGAGGTTGTGGGATAGTTTTTAAATGTGTGCTAGTGATGAACAGGTTTGGATATTGGTGCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAATCACTTAANNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCGCCTCTTTNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATACCAAACATAATAACATCGAAATTCTTCTCGGCTTGAATAATTGGTTTATTGATCAGATTTATCAAAATGT
TTCATGCTAAGAGAATGATGTTTGTGGAGGATACGCCCCTTGGTATTCTCAAGTGGTCCAAGCCGGCTGCCTACGGATAGGCCGGCCGACTACACTATGGGTGGTACATGAAACATGCCG
GCATGTATCACAAGGTGCACGGAGGATAGAGATAGATTTTAGTTGGGGAGAAGAAGTTGCAATTGGATCAAATATTTTGCTTTGTAACCAACTAGGAAATAAATATAGTCCANNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATCATGAGCATGTAACGTTGCATTACTACATCAGTC
TTGAGGTCAAAGCAGGCATGGGGGCAAGAATTGGGTAATGATGGATTTATGTGGAGAATGTTGAGAGCGAAAGGTCTCCTCAAGCCAGTGGCGAATCTATTCTAGCCTAGGAGTTGGAGG
TGGGGGACCTCTTCTTTCTTCCTACTCTCCCTTTGGAGGGAGAGGAGGGGGGCTTGAGCCCCTGCACCCTCTGGATTCGCCCTTGCTTGAATCATGTTTAGAGGTGTACGTATAATCTTA
ATCTTAAAAGTTGCTTCATATTTATTAGCTCAGAAAAGAGTATGAAGCTGAAAGAGTATGAAGCTGGAAAACGTAGGGTAGGACCTCCTGCTACGGCCAAACTCAATCCACCAAGAGAGC
TTTTATTTTGAAGCTAAACTTTTGTGTGTGATCAGGCTCACCTAGCGAGCCCTGACGTTGGACGAAATTTGAGCTGACATCTCTTGGCANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAGGAGGACTCCGAAATGT
TGAGTCACCGGCTACCTGAGATGGGAGAGATGGGAGGGGGATCGGTGGGGTAGAGGAAGAAAAAGAAGAGGAGGGGGATCCCTCAAAAGTTCAATTTCTTTTACCTTTACGTGATCGAAG
GTGGGCTCCGAAATTTCAGAAGGTAAAAGAAATTGACTTCTTCAACCATCACGTATTACTAATTGCAAAACTTCAATCTAAATTTGCCATCCTCCAAGTCTGTGTCGTCTTCCATGTCTG
GCCAATGTGCCGGCACCAGCTCCTCAAGATCTCTGTTAACAGCGCCTTAATGGTGAGTCATGTCAGGTTCTCCCTAGAGACCCTCAGATAATCTTTTGAGGGGAGTAACCCAGGCTACTT
CGCCCATGAGGCTGAACAAGCGCATCAACGAATTGAAACTGAAGCACAGCATGGCAAGAGAGAAGATATATGAGTGCATGTGGGGGGATGGCTTCCTTATNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTAGTCGCCCTCCTAGCTCC
ATCTCTGATTATTATAACAGAAGACAAGTACCTAGGTGGAGGATTGAACACCACTTCCTATACTGGTTTGTCATCTGGTGGTACTTGAGCTCACAACATTCCTTCGAATAAATGAGACCC
TGATCCCTCAATAGGCTAAAGAACGACTGGATCAGCGATAGCTTATCAAAAAAATCAGCAGGAAGCAGAAGAATACTGACACTGAACCTTGATTGAACAGCTCCGGGATCGGGCCGTAAC
TGCGGAGAAGGTCCTTGAGCTCCGAGAACACGTCGAGGAGAACCGACACGTGCGGGTCAGGCCAACCGCACTTCGCCGGCCCGATTGCACGTTCCATGGCGACGATCGACGAGGGCGGAC
GGGGAGAGTAGAGAGGTTGGGGACGGGGAGAGGAAAGAGGTCCGGGGCGGAGAGAGGAGAGATTGGCGACGCAGTCTGCTGCAACAAGCCCAGTAGATTTATTTGGGGGTTTTCACGCCT
CCTGCCCGAAAGGGCTAAAGCCCTGAAGACGACGTTTCCCTCTATGGGTCATGCAGCACGTAAAACTGCCGTTTGGGCATTAATCCCGGCCGGCCCTCGCCTAACTTAACGGCTAACAAA
TACTTTTTTTATAATTACCCATCTTTGTAAAAAAAATCTGATTATATGCCATCTCGGTTGTGACCATTGTGCTTTACTAAAAGGAGCCATCTCTTCTTGTTTACCTCTGAAAACAGAATG
TTGCACTTGTGCATGCGTGAGATTGCGTAGGATGTCTTATGTGCAGGCATACAGATGATACAACCAACCTCTGCTTGAGCGCTTGCTTCACGTTGTCGCTTGCTTAATGCGTAACGGGGG
CAAGGCTTTCAGTTGCAATTCGTAGTATAGCAGTAAAAAAATTCTGCCTCGTGTTTTCTCATGTGATGGAGGCATAACATTCATTTGTAACACTGCAGTACCTTTTTGTTAGATGGGTGT
AACATTGGAGTGTTTAGTTTGTGTACGCAAACGCAGAATGTACACAGCCAAGACATGAAACCAACACAAACCAGCAGGGGGACATCCTAAATGATGTAGCTATAAATGGTGGGGTTAAAC
CTCCTTCGAGGGAAAGGATTGGGTGGTGTGGGAGGGGATCAACGCAACACCCCTGTATTCCTCTCGCACAGTTTTGTGCAACTTGTGATAAAGGTGATTTGTGCAACAAAAAAAAAATCC
TTTGTCGTTTAGGTTTTGAAACCCAGGGATGTCTCTCTCTAATAGAGTAGTTGAGCACAATTTTTAATTAGAACTCTAGTGTTTCAATAGCTAAAAGAACATAGTTTCAGTAGTGATCTT
TCCATTTTTGGTTGACAATGATGTATTAAAAGTTTTACGACCTTTGTACCATGAAATCAATAGATGGGATTAGTATTGTGCCACTGCCACGTAATCAATTTCGAAAACGCTAANNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTACTCTGGG
TGACGAAGCCAAAAAACCAGTCAAAATTCAATACATAACAACCAGGAAATATGGCTGAAAAGAGACAAGGCAGCCAAACACCACCGCCCGCATCGCACGAAAAAGTTAACACGTCCCCAC
TAACACCCATTGGCAACAACTTGTGGGCAAAGCGAAAATTCAGCTTTGACGGTTTTTGGCAATGCTTCACAGCTTCAGCTACATATTGACTCAGCTGCCACTTGACGAAAAACCTCCTTT
ACTCTAAAACACGCGTCAACACCCACCTGCAGTTGCACTGCATCCATGCATTGCCAGGGGTCCAAATACTGGGCAATAGCTTGGACGGCTAGCGTGCCGGNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCAAAGATAGATTGAAATCC
CGCTGTTGGAATAATTCCAATGGCTGTTGGCAGGCAACACTTCAGGCCCAACAAAGATACGGTCTCGCTTGCCACCAACACTGCTACTTACTAATTACCAGAGCACTGCGTTTTCAAGCC
CAACAAATCTAAAAAATGTTACAGGTCCAACAAACATAGAATCCACAGCATACGTGACCTAGCTTTCCTTGCAGAGGCCGAAGACAATTCATTTTTCTTAAAAAACGTGACCTACCTTTG
TTCTTTTATACTTTAGTAATTTTATTTCCATATTACTTTTTATTCATATGTGTTCGTATGATTTTATATATGCCACGGTAAGTTTATTTCTATAATGTGTAAATATTTCAAAACTTATAA
CACGTTATAAAAAGAAACTCGGCCCATCGGGAAAAGATCTCTCCAAAGGTATTGTATGAGAGGTAGAAGACAACCTCAACCAGGGATCAAGAAAATCTTCGAACCTCAATTTTTGTTGAT
GAGGGGATGTTTGTTAGCTCCTGTGCCGTAACTGCACTTCCATGAGGATTTGAGCACCGGCATGCTAAATGCTACTCGTTTTCGAACCTCAATTTTTGTTGATGAGGGGATGTTTGTTAG
CTCCTGTGCCGTAACTGCACTTCCATGAGGATTTGAGCACCGGCATGCTAAATGCTACTCGTTTTCGAACCTCGGTAACGAGTAGGCTAGATGCCCTTTCACTCATAGTGCTTTTATCAG
TGTCCATAAAAACTCATTGTAACGAATACATGAATTTTTATCAAGAAATTTGAGATCAGAATTTTCTTGATATTCTTCGAAACTTATGGAATTCATTTCTTCTAGCGGTAAAGACAATTT
TCGCATGGGCGAACCGCGGGTATCCTGACAAAAACGGATTGGCATGTACCAATCAGACAGATGGCATGGTTCCAAACTTTCAATTTTGGTATAATGCATTGTTGAATTTAAATAGGGCCT
ATTTTTCTCTCTATGTATTTTGTATCATAAAAAAAAATTGGTGGGGAAAGACCACGAGGGTCCACCCACCACAAGGATTCACACATGCCGGCCACAAGAACTAGCGAGTGATGTTAAATA
CAGATCCATTTAATTTGCACCAGGAGAGTTGAACCTGGACTTGCTAGATGCTACTCAAGTACTCTAACCGGACCCTTTCGTTATATTTTGTATTATAGCTACGGTATTTTGAAACATTGA
GCTTCGATCTTGAAAAGCGAGCATCACAATTCTGAATTATTTCCGGCTCAAAAGAGAGTTGATTGGCGAATTACAAATAATATTGCAAAAGTTCAATTTTTCTCCATCAATTATAAAACG
CAAGAGCTTCGCATCCGAATTATTGCCCGGATCTTGCACGAGAGCTTCCAGCCATGAGCTCCGTCAGGAGGTCAGAGGTTGAAGATTGAGGTTGGAGGAGAGATTGGGGGCACGATAAGG
TTAGAGGAGAGATGGGCACGATATTTCATCAAGACATGTAGGTTATTTCCACCTTTAGCGGGTGAGCCCAAAACAGGCTAAAGCAATTTTACTTGTATATTTGTGTAAATGACATTGACA
TCCGAAAACCTAAGTGTGTCACATTTTTTTTTCTTTTGACTATGAACCTTTGAGACGAATTGAACTTCATTCCCCCATCCTCTTTCTCCCTATATTTGGCCAGCCAGCCAGCAAGTGAAC
GGTGGCGTCGCGCCATAGCTACTTGCCTGCTTCTATGGAGAAAGAAATTAAGGAAACAGGAAGGGTGGGAGAAAGAAAGAAAACAGGAGTGTGCGGTTTGGCAAAGTGTTTTATCAGGAA
AGGAGGCCCAGAGGAAAATGAGAGGCCGGCCCAGCCCTCACCAAAACATCTTTTTTTTTTAAATATGGCTTCGACCTTGACAAGCGAGGATCACATCTACGTGTAGTACTTGAGATTGGA
TATGCCGAGAGGGAAATGGTGTGAGCTGCGACACCTGGCAAGGCCACACAGACTCGCGTCGCAGTTCGCGGAGCCCGGCCAGGGGATGCCAGAAACATCCGCGGCGGTGCGGCACCGGCG
CGGAGCAAACCAAGCAAGCAGCAAAGCGGCGTCTGCTTTGGCGTTGCATGCTACGGCTCGTGGGCTCCAGATATCGGCGTGGCCCCCGCGGAGATCCACCCGCTGGCGCTGACAGGGAGG
TAAAGCAGAGGCAGGGCAATGGACCAGCGCGGCGCCGGGCACGGTTCACTCGTCTCCAGACCGCTCGCCGTCTCTCTCTCTCCCAGTCTCCCCTCCCGTCCCAGTTTCACACTCGTGCCT
CGGCGTCTCCGATCAGCTCGGCTCGGCATGTGAGATTCTGACTGGCGGACCGGACGGACGGGTGGATTGGATGCCGCCGTGCCAAAAGGCATGATGCGTACGTAGCAGCATTGACAGAGC
TTGCGTCTGGTGCATATCTTCAGCACAGTACAGCCACGGAGCCACCCCAGCCGGCTGCTCCTCTAGACCTCTACTCCTGACCACTGCACTGTGCGGTGGTCTACTGGTCTTGCGCTCTTG
CTCTCAAATTTCCTAGACTGCCCTCGCGACACTGCAGACTGCAGTGCAGCGCAGCCTCCCCTTGTTTTTTTTCTTTGGGATAAAGAAAGCCTCCCCTTGTTTTGAAGCCTTGAAGGAGAT
TCGCTTGTAGTAGTAGGTAGTACGTGCGATACGGGCGTGTGGTTGGAGGGGGTCGTTGGTCCCGTTTTAAAGAGGAGAGCCTAGTACGGGTAGTACCCCTCTGCATTTGGAGCATGCAGT
TTCAAATTTTCAATGCAACTTGGGGGAGAACGGATCCCCGACGCTCGCTCGCATTCAATGGCCCTTCCCAGCCGAGCAACCGATCGAATCGACGCTCGCATTGCTGCCGCGGCTGGCTGA
ACGAATGTTCTTTTCCAAATTTTGAAAAAGTCANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTTGAAAAACAAAGGGACTGCTTGAGTTCTCCACGAGAGGTTAAGATTATCCACCAGAATGAAAATCAA
ACTTATTGGCCGCAGGGGGTCTGGAACGAAATACGAAGAAATCATCTTCTTTCACGAAAAGACGAAGAAATCTTTCTAGTACCAATCCTATCTTATCCCTCACCATGCGGAGCCAGATGC
CCAAATCCTAGCTAGTCTATTTAGGCATGAGCAACGTCGCTTCAGCTGCGGCGCCGGCGCGTGCGGCCCGAGTGCGCGCAGGCGATTGATCGATGGGCCGATGGCCGCGCCGCGCACGTA
CGATACGGGGGACGGGGAGCCTCTTGATTTGTGGTTGGCATGTCGTACGCCCACGGCGGCCTATACTCGCCGGGGGCAACAACATCAATTCATGTCTGCATCGGGCACCAACTCCGTATG
CCTTTTACTCTTCTTTGTTATCAAGGATCGTTCAGCTCTTCCACACGTACTGCCCAATCTTTTCTAGGCAAAAATGAAGAAATCCTCTACAGTTTTACTGTCACGAGCGTGCATAATATG
TATGCCATATTGCCAACGGTCAGCTGCGCGCCTGCCCATACGGCATCCAACGTCTCACTTCAGATCCTCGGTTGGGGCCGTGTGCTCCCTTGCGATCCATGTTCAAACTTGCAAATCTGA
ACTTTTAAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCGTCGTGCCTATGCGCGGTCGATGTTTAAACTTGCGTATGTGAACTTTCTCTACACTTTAAAAA
GACGGTTGAAACAAGAATCACATTTTTTAGAAAAGAAATTGTTCCAACCTCTATGATCGTACATAAAGTCATTCTTAACTAATGCCCTGTTTGACGGGGCTTTTTCCAGCTTTAGTTTCA
CCTATTTTACGCAAATTGAGGTACTACAGGATGAAGCTATTTTGGAGGCAGCCCTGTCAAACAACCCCTAAGTTGTGCCAGATGTTCTTTGAAAAGAAATATTTGGAGGCATTTGGTTTA
TGGTATTTGCCACACTGACATGTGGATAATTGACAATATTATATAGGGTAAGAATTTGTTCTTTAAGCTGTTTAGAGCTTACCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCATATATCTATTACCCCCATCCCTTAAAACAGGAATCAT
ATATGCCAAGCGAATTAAATTTATCAATTTAAGGTTGCTTGCTTGTTTTCTTAAGGTCATAACTTGGCCTCTTTTGCATATTGTGATGGCACTCTTTGGCTGCGCTTTGGGAGTTCACGT
GCTAGGAGCCGTTGTTTTATATTGTATAACTTTCTCCTATTCCTACTTAATAGAAAGACAAACCTCCTACCACTTCCATTCAAAAATCTTGAGAAAACATAAGGTTTGAAATGTTATACT
ACACAGTCAATGACAAAAACATATTACTTTAGACAAATCTAATAGATTTATATTTATAATTGGAAAAATATCTATTTTATGCATTGTCGTAGTAATGTTTTATTCTACTACAAGTCTGCA
AAAACTATCAAACTATGAACTGACACAAAAGAGACCTAGAATAAAACTCTAAAATGATTACACTTTTAAAACAATATATCATGACTTTAAAAAGCTACAAGGTTGATTGCATCTACTAGC
TTTCTAAAACTGGATAATTTTATAAACAATAGTTTTTTTGGTGATACTCCATAAATGCTTAGCATCTAAAAAGTCCCCTAGGAAGTTTAATTCCCACAGTCAAGATAATAATCCTCGTAT
TCGCATGAGACTAAATAAGAATAACACATAACTTGGCGACCGTCATGCAATAACATTTTTCCACACATAAATAAACAGTACCCTACAAAACCAATTCAATATTACAAATAAATAGTAATC
AATTTCAATACATATGAGGGGACAATGGACCCTTATCACCATATTGTCTCATATAACATCAAGGACCCTTTTCACCCACGTTTCAAGTAGCTAGATTGCAGTTGAAGAGATTAGTATGAA
TAGGAGATTTTATTGATGCCAATTTTTGGATTCACCCAAACAAAAAAGGTTGATGTTAGTCTCATCTGTTGTATCCGCCCATAATAACAATAAAACCATCTATAAGAGCCTTTTTGGAAT
AAAACATTGCAAAACAAAGCAAGGAGGGAAACACAGGAACGAGGAAGAGGGAAAATTGGAAAACCACAAAATTCCAAAACGTACGAATTAGAAAGTTGAGGTGTTTGGATTGTAGGAAAC
AATTTGCATCATCATCTATTCCTAACAAATAAAACTCATTTATCTTTAGGAGAAAAATTTATTTTTCAATGTATTTTGTCATTTATAGGCAAAATACTCGCCTTGAAATATAACCAATAG
AGCCCACAATATAGTTATTTCGACTCCAACCAACTGCACATCGTTTTCTTCTACCTTCGTCTCTTCCCAGGAGCCATTCCTCCTCCTTTCTCTCCTGTGCGAAAAAAATCCAGCCAAATC
TCGGCCTCTACCCGTAAGCTCTACAACCAGCAGCTAAAATCGGCCACCCTCCACGCTCTCTGCCGCATCCATTCACTTGATAGCAGCACATTTGATCAAATCAAAAGCTACAAGATTGAG
TAGATCTACGCCAAGGTGATTCCTCAACCAAATTTTTCTACGGGCTCAAACCATGGTGTAATGGAGGGGACAGGAACAAAGCGAGCAACAACAAAAGCAAGAGCTAGCGAACTTGTGTTC
CCTTGTGTTGGATTGGATGTTTTATTTCCTGTGTTTTGCACGTCGACAGTTTCCTTTCCTCCGGAATGGAACTCAGCTTTCCTTTGTTCCAAACGCAAAAACACGATTCCTTTCCTCTGG
AATGCATTCCTCCAAAATTCTTGTGAAAATTCTTCGATCCATACATGGCCTAAATATTGGTTATGAAATTTAAATTTTGAAGTCAAGAACAACAGTTGGCCAACCAAGCAAACCAGCCCT
ATAGTTACGCAAAAAATATAGTATTAGTGTATTTGGAGAGGATATCATTAAAATGATTCGTCATACGGGTACAAAATTACTATTGATGTGTTAATATTTCTCCTAAAATTGTATAAAAAA
TATTTTGCGACTTAAATACTTGGTTAAGTTTTGCAATCCATCGTGAGTGCTATAGCATGAATCTGTGAATTTTTAATAACATACGCTAGACATAAAGGTTGTAAATTCTCGTTTCAAGAT
GTCGATTTCATATCACACGACTTTTAAATGTATAAATCATTTGTCCTGGTTCTCGACTTCTAATGTATGAATCCAGAACACAAACATGTCTCAATTCAATGAAATGTATAAAATCTGAAC
AAGAGCTCCAAGCCTAACAAACAGACCAAAAAAAAAGTTCAAAATTAAAAACCCGAACCAGAAGGAAGGATCAAACGGGAGCTCACCCCACCCGTTCGTCTCGAGTCCCAACGGATNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNAGCATAAAACAATTCTGTGGACGATGAGAGAGAAAGAGGGAGAGGGGAGCCGAGTAGTAATGGCAGGGGGAACCTTCTTTTCCTGACTCCCTGCGGCCGCAGCTC
ATCATTTGTCCCTGATCCTTGTGCTTCGTTCCTGTTGCGCTTTTCTTGGGCCATCGGTGGACTAGCCGTCGCGAGGGAGAAGAAGGCCACACCACAGGCGGGGAGAGGTGCCTCGACATT
GCCTTCCCCACGATCTTCTTCCTTCATCAATCACAGGTTCGTGTTCCATCCCCCTGTCCCCTCGATGGCCCCGTCAGTGGACTCTTCGTTTATCACCCTGCCATTTGCGAGGAAATGCAG
GCCTGTTGTCGCGAGGGGATTCGGGTGGGAGCCCCTCGCGCGTTCTCTCTGTTGTGCGATCTGAATTTCTCTGTTCTTGCGAGGAAGATCTTGCCATTCTGACCTGATTTGGGGAATCAT
TTTTTTTGTTTTCGAAATTCGGTCATTTTCGTGCTGACTGTTCAGTTTCCGAATTTCGCGCCGTTGCGTTATTTTGGTTTCTTTTTTTTTCTTTCTTTCTCGGCAATGTGTGCTGTTCCT
GAATCCTGGTGCGGGCCTGTCTGATTTTTGAACGCGAAGGCCCCGTCTTCCCCGTCGCTCCATTTCGTCATGAAGGCGGAAGCTCTGCGCCGATCGACCAGCCGGGGATGAGATTGAATG
CGGGCTTTTCCCTCTCTGATCTCTGGTTTGCATCCTCTTCCTCCAGTTCCGTGTTTCACGCGGAATCACTGGCGCATCCGTCTCCCCGCGGATTTCGACATGAAGTGCTCTGCTGAAACT
GAGCTGGGCCATTCGATTTTGACAACAAAAAATTCGCCTTTCTTCGTTCTACGCCGTTTTGAGTCATCAGCACGTTCTTGAATGTTTCTGCATTTCTCCTTCCTCGCCTCTGGTGTTCTT
GTGATCCATTCCCCCTGAATATTTTTTTCTACCTGGAATTTCATAGTTTGTAGAACTTGCAGCAGCAGCAGTAATTTCGAAGAGCTATTAGGGAAAGTTGTTCCCTGTTGTTATGTGCTT
TGTTGAGCTCCGAGCCACAGGGGAGTCCCCAGCTAGCACGCAACCATTGGGGTCCATGGCCATCTCTTTTCCTGCTCCCGAAGTGAACGAGATGGAACATCCACGTTCCCTTTTTTTTCG
TATTTAATTTCTTTTTGGTTTTCTATCGCTCATGGAGAACTGTGCCGTCGCATCGACTGATCGACCTAACCTTTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTAAGTTGTCGTTTACTGTTACTGGCCGTCTGGCCTGACGCGGTTTCAGTTTTGGAATCAGC
TTCAGAGGGCGATGATTCGGTCTCTCTAGAGAATACGTAATAGTCCTTCCAGTTGGAGAAGATTGCCATCTTTGAGAAATTTTTGGGTCACTGAAATTGAGTTTTCCTCTTCAATTAACC
TGGTTGCAGGCAGTCCGGTTTCATCTGTTTTGCTCCCTTCAGCCCCATTCTTGATGCCCGTGGATTATGGTGCTTGCTCCCAAGATTTGTGTGAGACTAACAATTTCCACCCATTTGTTT
CCCTTGTTGTCTTGTTTCAATTGGATAGTGTCTCTCCGTATCTATTGCTTTGTAAATTTGAAGCTAATGTTTAGCCAAAACATTGACTACTAGTACTGAAATGTAACTGCTCTTCACCCA
TCAGGTTGAGCAAACTAAGCTGAGATGGAAGGCCATGTAGCAATGGAGGAGTGGAAGGATCCTAATCCACCAGAATCCTTGATGCGGGGCTTCCAGACCGGAACATTTCCACCAGACGCA
GAGGTTGCCAAGGCCGGATTTGAGAAGGAAGGCCGGTCGCTGCCAATGACCCCGCAGTTTGGCCAGAAGTCCAGTCCGGGCAGCAGCCTCGCCGAGAGAATGCAGGCAAGAGCTGGATTC
AGGGTGCCAAAGCTCAGCATGCCGTTCAGCACTGCAGTTGGAGCTGATAATTCAGTGCCAGGAGCTCCATCGCCCTACCTCACGATCCCTCCTGGTTTGAGCCCGGCAACACTGCTGGAC
TCACCAGTCTTCATTTCCAATGGCATGGTATGTGTTCTCTAGGTTACGATTTTGGTGCGAAGGCGTACTGGAATTATTTTACCTTTCATCTATGGGATGCTAAATTGGCAGTTCAAGAAT
GCTTGCTTTACTGAACTTTTGACCTATTCAGAAGTCTGTGAAAGCTTAACTTTGGTTCCACGATCAGTTTTGCTTTGTTTTCCAGCATCCATAGTCTCTTCTTTCCAAACAAGCTGCCAT
TGTTTTCTCAAAAGCAGAAAATAGTATAGTATCATTCATATCTTTCAAAGTTTTCTTCAAAGCAGAATTGATATGATCAATCTCCAATCTTTCCACAGTAATCTAGTAAAGCACACCCCA
CATTTCAAAGCCAAACGTCCCCCTATGTCCCTATTTGGAAGTCTTATAGTAATGGATGTTAATGTTGTGGAAGCTGGGATAGGAATCTTATGTGTTTTTTCAGTTCTTATTATATACACT
TTTGAACCATGTCCTCTAATGAACTAAATGTGCATGACGTGTTCACTGTTCATAGATATGAACAAGAACAACTATGATCAACTGAAAAAAGGCACTTTGATCCAGAAGCTATTAGTTATT
TACACATTTTTTTCATGTATTGTTTCAGGGCCAAACCTCGCCAACCACAGGGAAATTATTCAGGCTTGGTGGAACAAATGACAATGATCCTATTAGATTTGGAGGCTCTCCACTTGGAGC
TGGCCCTGACTCATTTTCTTTCAAGCCTTTAGATCTGAAATCCTCACTCTACACTGCTGAAGGAAAGAAGGTTAGTTGCCCTTTGACTAGGCTATAGGTTATTCCTGTTGACATTCATTT
CCATGCTAATGATAGAAGTATCTCTATACTTAAAAAGTATTTCTATAACCACGCAGTTGCAGTGATTTCTGTTTCCAAAATTTTACACCAAGTCTTGATGAACACTTAGTTAAATCAGAA
GGATTTTGCTCTGTAAGTTTTTTTTATCGGTTGCATACCTGTAACAGATTGGCACACAGTGTTGTTTTTTTAAAAAAATGATTGGGCCACTGTTGCCTATTCTTTGAGCTTTAGTGACAC
CAGTTGTAGCGAAGTGGCTGGTAGCTTTGACACTACCATTTTGCCCCTCTTATTTTTCATCCTAAATGGAGAAAGGACAAGTTGGACCAACCAGACTCGGCTAGAACTAGATAATTTACA
AGTTTAATAAAATAATACTCGCTATCAACTATATGGTTAATTCGCAGTGGCTATCCAGTAGATGTTTTTGCTCCCACTGTTAACTGGTGTTCTTCTTTCTTCTTCCTTTGGTTCAGTCAG
GATATGAAAAAATGTTTTCAAAAGTGCCAATGAACCATTTTATTTTCCTTGTTCCTGATCCAATACCTGTTTGCTCTCCTTGCATTTCAAGCTAATTCAAATTTGCTTCAGGAATCTTTA
TGCAACAATCAGCCTCCACTACCAAGCACTCATGTTTCTGTCAAGACTGAAACTAAGATTCAGCCTGTACAAGAGGCCAATTTGCTGGGCAAACTGAATCAGCAGAATCAAAGCGGGCAG
ACCAATTTGAAGAGTGGTTCTCATGACTCCAAGCTCAGCCGTCTTGCACCTGTCACTGGTGCAGGCAATGAACACGTATCATCCCCGCACGGCCAGCCCATGGAGGAAGGCGACGCTAGG
GGAGGAGACTACACAGCAATTGCCACATCTACACCGGCAGAGGATGGATACAGCTGGAGGAAGTACGGGCAGAAGCAGGTGAAGCACAGCGAGTACCCGCGGAGCTACTTCAAGTGCACG
CACCTGAACTGCCAGGTCAAGAAGAAGGTGGAGCGATCGCACGAGGGGCATATCACAGAGATCATCTACAAGGGCACGCACAACCACCCGAAGCCCACTCAGAGTCGCCGCCCAGGAGTC
CCACCCTTGCACCCGTTTGGCGACGGTGCGCAAGCGGAGGCGCCCGACAACCAAGGGTCACATTCAAACGTGGCAGGAGCGAGGCTTAACAATGCGGGTATTGAGGACCTGCATGGAGAC
GGCACGGATGCGACGTCACCCCCCTCTGTTCCCGGTGAGCTCTGTGACTCGTCAGCATCAATGCAGATCCATGACGCCGGTGGTTTGGATGTGACCTCTGCCGTGTCCGATGAGGTGGAC
GGGGGCGACAGGGTGACTCATGGCAGTCTGTCCCAGGGTGGTGCCGATGCTGAGGGCGACGAACTGGAATCCAAACGAAGGTCAGTACATTGTATCGTGTATTGTAGATTTCTTACTGTT
CTTTCTCGATCTGGACCTGACCATCTGATTATTTCAGGAAGCTGGAGTCTTACACCATCGATATGAGCACCGCCTCAAGAGCTGTTCGCGAGCCCCGCGTGGTGATCCAGACGACAAGCG
AGGTGGACATCCTCGATGATGGCTACCGCTGGCGCAAGTACGGGCAGAAGGTCGTGAAGGGCAATCCAAATCCAAGGTCTGTCTGAAATATCCCAACTGTTATTTTTTTCAGAGCCCAAG
AATTGGCCTTGCTCTGTGCTTGCTAATTGCTCTTGGCCTTGCTCTGTGTTTGCCAATTGCCCGTCTCACCTTGCGCGGTCGGGTTCAGGAGCTACTACAAGTGCACGCACCCGGGCTGCT
CGGTGCGGAAGCACGTGGAGCGCGCGTCGCACGACCTCAAGTCCGTGATCACCACGTACGAGGGCAAGCACAACCACGAGGTCCCGGCTGCCAGGAACAGCGGCCACCCGAGCACTGCAA
CGGCGACGGGCGCGGCCGCCGCGCGCAGGCCGGAACACCCATCTGCGCATGACGGCCTGATGAGGCACCTGGGCAGCTGCGGTGCGCCGTTCGCCCTGCCACTGCCGTCTCGGGATCCGC
TGGCGCCGATGGTCAACTACCCGGCGTACGCCTCCGCCGCCCTCGGTGGCAGCGGCGGCTCTGGGTTGCTGCCGAGCCTGCTCATGCCCGGAGGAGGACCCCTCGGGCAGGTCGAGGGGC
TGAAGCTGCCCATGCTGGCGCAGTCTTCGCTGCAGCAGCAGCACCCGCTGCTGAGGCACCGGCAGGCGATGCAGGCCGCCGGGCTCGTGGCGCCCAAGGCGGCGGACGTGAAGGTCGAGG
GCGCCGGTGCCGCGGCGCCGTCGGTGTACCAGCTGATGCGCAACGGGCTGCCGCTGGGCCACCAGATGTAGATAATAAAAGAGAAGAGGATTAGAGAGCTCTGAGCGTGATTCTCAAGTT
AGTTGCTTACCAGTCGTGTTAGGATTAGTTCGTGATAAGTACTACAGCGTGGAAACAAGCACCATCCCTTCTTGCTTCCGGTTTTTTCACCCTTTTGTTAGTTCCAGCAATCTTTTACTG
CTTCTATTCATTTTAGCTTCAGTTAAGTTTTCGTTCAGCAACAGCATTTCTTTCTTTTAGTGGGTTCAGCAACTCCATTTGGTGCCTCTGTTTTTTGCTTATGCAAATGTATGCAATTCT
TGTCCTGAGAAAGACCCAAGCGTGGCTGGGCTGGCCACTTTGCATCATCAGCCCAGAAAGCATGTTGTTCGAATTCCTCATCAAGCCCATCACGAAAGACTCTTATTGGGCCGCATAAAA
TTTGGGCTGGATTCTGATAGTAGTACCAAAAATTCAGAAGTAGTTTGTCCTATTCTAAAAGAAGAAAAAATAAAAAAGGAAAAAGGATTGTGGTCGAAGTCATGGAGAACCACCGAAAAA
ACAAAGGCCATCGAGAAAGGGATGGGGTGGTGCCTGACACGTCCCTCTCTGTCAGCCTCACCGACGTGTACGGCGCAGCAGTGCAGGGCACGGCATCCGCTGCGCTGCCTGCCCCCATCC
GAGTTTGATTAGTCAAAGCAGAAGGCCCCCCGTCCAGTGCCTAGTGCGCGCCACACGTCGCGCCACCGCGAGGGCAGAAACGGAACAGGCGCGACAGGTGCGTCTCGGAAAGGGAAAGGC
CTGCGCGTTGTGGCCGCACAAGCTGCACCGCATGGACGGGCAAATTACGCATCCGCCCCTCAAGCTCGATTCCTGTCTCCACCCACGAGATGGCCGACTAGTTTCAGCCGAGTTTACAGG
AGGTGATTTCTTAGACAAGGTAATCTCCAACCAAAATCATAAATACTCCCTCTGTTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCACTTAAATCTATAC
TGATATCCAGATACATAGAAAAATATTGTATTTAGAAAAGTAAAAATGAATTGTAATTTAGAATATAAGAAGTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTAGA
CACACACAACTACATACTTCAAGAGGAAGTATAGGAATGAGGCTTACGGGCTCCGTTGCAATAACATGTTAAAGTTGTTTAGTTATCTTTCATTCGTGTGATTTGAACCTCCCATTCTGA
TTTATACACACATGGCATGCTATTGACATACACGTCATCTGCCATTAAAAGAACAGCTAACCTGAAAGTTAAAATACAAGCATCTGTGTGCNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTAGATAATAAGCAGTTTTCACTTTTCACCGTAAAGAATATAGCCAACTA
AATTAAGCTTAAAGTTGTACAAATTTATGTCAACATTCATCAACCCATGCTCCTAGTAGTTTTATGGGACAAGTGTTGCTCTTTATCAGGCTATGATTTACTTTATACAAATTACTCTTT
ATATTTCTCGCATCCCCATTCATAGTTTCCTCACCTTTGCATTGGACCTCCATGAATTTATTTGAAGCCTTTACTTGATATATGTATTTGATAACATGAAAATCGATATGTTAACGCATC
TTACTACGTGGTGTATGTGACTCTTTATATTAACAATGGTAAAAGTGGGAAATTTGGAAGCACAAGAGTATATAGTAGTGTTTGAAAATTTTTTACGATGATTGAGGGATGAAATTTTGG
CGGTATTATTGCCGATGGTCATTAGAGTCTATCAAATTGGGGGCCACTTTTTCAGATTTTTTTGGGAGATATCTTAATATCTATATCCTTTTCTAACACATCTCGAGAAGGTTAACATGA
AACCTCAAAAAAGGTCTATGATTTGGAGCTAAAAAATAATCTCTAATTTATTTAACTACTAAGGGAAGAAAATATGTGCTTCCACATTTTCTCCGTTCCTTCAAGTTGACCTCTCTTTTT
TGAAACGTAAAGCTAGCAGGAGATTTGCCAGATTTATATATTAATATAGAAGAAGGTTACAGAGACCTAGGCCAAAACGTGAAGAGTACAGATGTGAAAGAGATCGCANNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAATATCAATTGGTTTTGGCGCAGGAAGTTTCTTTGAAAAACCCGGGC
ATTTCCTTCTTCCCAGAGCTCCCAGCAAACAAGAATGAAGCCAAAAGTACCAATTGTACAATCTCACAAAAAAATCAGCAAAATCCCCATGGCTGACGCCTCCCCCGTTTTAGCAAAAGC
CATTTGGACGAAGAACATGGACGAGTCCTAGGAAGCTACCTGAAATTTTCAGTGGATTGCACGCAAGAACCAGTGCCGGAAATGCCAATGTACAGATCGAGGGGGCCAGCTGGGGAATTG
GGGATGGCATGGAGATGGCCGATGGCGCTTCTAACCACCGGCCTGGGCGTCCCCCGTGTCCCTGTCCTGGCGCGTCCGTTTCTTGCCTTTGAGAAAGGATGCAAAAGCCATTTGGATATA
TGCTCGATCTCGCTCCTGAAAAAAGGGGGCACCACCTTGTTCCCAGTTTCAAAACCTATGACGTCGTAGGGACGAAGAACATGGAAGCGATTAGCAGCAGCTACGTACTAGCTTCTTTTT
TTAAGCCTAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNTGGCATACTGTGTGGCGTGCACAGGGAGGGGACGACGTGTGAATTGTGATGACGCCCGTACGCCGTTCATTCGATCGATCGGTTTTGCATCGATGGATCGAACA
GCCGCATGTGCGCCGATCCTCTGAACCTGCCCGGGTTCTGGGGACACACAGGACACGCCGGTATGGCGGGTATAGTAGGTTATCGCCTCCGTTTCTCTCACGCAACTTAACATATCTTTT
TAATTAATTCTTTTTGCGAATTTTCATGAGTAACTAATACATGAATTAAATTCGTTAGACGGGGTACTCCAGCAGGCTAGCGGCAGCGGTGGTACATCGTGCGAGAATCATCGGACGCAG
CATGGCCTACCGACCGTCGCTGGCGTCCGTGGCTGACGCGACACGGCGCAGGACCTGACGCGGTGGCGCCATCCATCCACGCGCGCGCGCGGGCCACCGGTGTGTGCAAGTGCGGGGACG
CGCGCCGGGCCGGCAGGCGCCTGCGCCCACGCACACGCCCGAGGCCACCACTACCGAGCCACCGGCCACGCTCGTAACAAGAGAAGCAAAGCAGGCGGCGGCAGCAAGGCGTGCGCGCGC
GGTGGGTGCGGTTACCCGTCCACGTCCGGCGCCGGATCGGGGGCGTCTTCTTAACGCCGGGACGTCGGGGATGGCGGGGGCTCTCGTCCCGTCCCGTCCCGTGGCCGTGCCGTGCCGAGG
CCCGGAGACGAAACGGCTCGAGACGGGCAGGGAACAGTGGCGTTCCGCGAGGGTGAGCAGAAGTGAAGGCCGGCCGGCAGGCGGGCAGGGAGTAAAAAGGGAAGACAGGGACGGGGGGGA
AGAAAGATGTGGGGGTGAGACGCACGATCTAGCTATTCCTATTCCCGTGCAAGGCGGAGGTGGGAAGGGAAGAGGGGAGCATTGGGTTGGGTGAGGACGAGCTTTCGTTGTCACAATTCA
TTGCGGGATGGACCCTTTCTTTCTTTCTTTCTTCCGCCCGCCCGCCCCCCACATTTATAATCTTGGAGAGTCGCCACTGGGCCCACCCGAGGCCCAGGCCCCAGGGAGGGGACATGATTA
GTGTCTTTCCTGTTGAATTTTCCTTCCTAACATTTTGGGGGGCGGCTCCTAAAAAAAGGACGTTTGGGGGGTGGTTATATATGTATCCTGTCGAACATTTTGACCAATCTTGGTTAGTTG
GTGCATAGTGGTTTTGTGTTTCTTCACGGTGAGAAAGATCACAATATTAGAAGTAGGGGCGTGCTCTTTTCCATTTTTCGTTGTTGGGTTATTGTTTGACTAGCTGGTGTGCTTTTTAAA
GGAAGCAGTATTGCTTTTGATTCACTCTGGGAGAGAGCATCACCATCGGATATTCTAAATGTTGGGGACCTATTGAAGAGACGGAAATAATAAAAAGACACGAGGATACGGAAAAAGTGT
TTGAATTCTCTCTTGAAACCATAATGGTTATTATGCAGCACGGGTGGCACCCAAACCCTAGCTGCCGCCCGCCCCTCCCCACCCTAGAATGAGGGCGGTGGGATTGTTTCACCGCGTCTT
CACTCGGCCAGCACAGATCTGGGAGGTGACAGTGCGAGACGACGCTCGATTTCGACGGTGACAACGGATGCCGGCGACACAGACGACGGCCGATAGAGGGCGTAGATGGAGGCGTGCGGC
CTCGGAGACGGCCCAACGGGCGCGAAGGTGGGCCTGCGGCTCAGCGGAAACTGTGCGACGGCCTCGCGCGGGAATGAAGAAGCCGCGGCTTGCAGCGGCCGTGGGTACGTGCGGAGGTGC
GCTGGCGGCTGCTAAGCGTGGGCGCGAACTCTGCGGCGAGGAGGAGCGGCGGGCTAGCCCTGTGTCGGTAGCGAGTTGGCTCATCACGCGGCAGCTCAAGGGTAGCAGATACAGTGGCCT
GGAGGCTGGATCCGGCGTTCCAGGGCCTGATTTGCAAGCAGCCCCGGCAGCTGGTGCGTGGAGGCCATGAGTCGTGCATGGAGGTTGGCAAGGCATGCCGGTGCTCGCACGCGTGGGCCG
ACAAGGAAGCCGCGCGACAGCGGCCTGGCGAAGCGTGTGGACATAGTGCGTCTGCGGGTTTGGCACGGTGCGAGGAGGCTGTGTGGCGCCCAGTGTAGCGCGAGGAGGTTGAGCTAGCAA
CTGGCAAGGACGTGCGGCTACAGATCGCGCAAGCAAGGAGGTGCGGCGGCTCGAATGCCACAACGCCATGGTGGTGCCGCAGTACAGTGGCTACGCGTGTCGAAGAGGTAGGCCATGCAG
CTTGTGGCCGCTCGCGTTGTGCCATGGCAACGCGAGTTGTGTGGTGGTGCATGGTGTGGGTCTTAACAGCGGCCCGCGACGAGGAGGATCTACGCTGGTGGTGGAGTGGCGTTGCCGTCG
GCGTTAAACTGTGTGTGAGATGGGTTGTGCGCATTGCGCAAACACTGACGAAAGCTTTAATCAGTTTTACCGATTACGACGACGATGTTGTGCCGCTCCCCTCCTTGGAGGCGTTGTCTC
GGTATTTTTGCACACCCCCTCCTCTAGTCGACGTTTGATACGTTTAGTCAAGGTGATGAGCCATTGTCTCTGGAAGCTTTGTGTCCACGCACGTGGTGTAGCTGAGATTCCGACGGCGGA
AAGTGGAGGTGAAGTTATTGGAGCAACTCGGTGGCACCATGTCACCCCCGGCAGCAAAGCAAGTCCGGATCCTTAGCGTGGAGTCTAGCAGCAAAAGTGGTGAGGCCCCGTTCGCTTTAA
GGTGATATGTTCGAGGAGTGGTAGGCGGTGGTGGATGTGGTGAGGCTCTCACGCGTTCAAGTTGCCTCGGAGGGTCAGGATCCGATGCGGCATTTTTCGTCGTTTGGTGTGCATGACGCT
ACAATGGTGCTTCGGCGTTAGGTCCTGCATAGCAGTGGCCTTTTTTGGTGTGGTGTCGTGGATTGGGTGATCGATGACCGTTTGTGCGTGACCTGAGGATGACGGGGGCATGGTGGAGGA
GTCGTGGTAGCTACACGGCTTGCAGCGGACTGCGACGGTCAGTCCTACGTGGTAATGGCTGGTTCGGCGTGGGATATCGTTGGGGATGACGGCACTGGCGATAAGAGCTACTTGTCGGCT
TTTTCTCCCGGGTTGTGGTGGTGTGGCGTAGTGGTTGGTACTCACGCGTTAGCATTGTGCGGCTTATGTCGATGTCTCAATCCGACCAGCCACAAAGTTTATTTTGTTTTGAGTTGAGTT
GGGTTCGGCGTGATCCGTTGGGAGTTACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTAATGGT
TATTATGGTCATATACATAAGATCTGTTTGCATGTCTTAAGAGCGTACTATATATAAATAAAGTTTGGTGCAAACATTAGTTATATATCAAAGAAACCCCTCTAAAAATGGAGGGAAATA
ATATTTGTGGTATATCTTGTGAAATTGCTTTGATGCATTCCCAACACTTAATTTATCTGTTTTTATTCGCAAACAAAGAGGACATTTTATCTACTTTGACTCATGCATGTTGCTCCCCTA
CTCCTCCAAAATCCTTTTGTTCTCGAAATGTCATTTCCATTTCCTCATCCTACAGCCTACTAGGCAAGCACCACCACTACAATCTAGACGTCATGTCTTGGCCGAGCCCCCACACCACAC
CTCTATACCTGGTCTTAATGATCTCTCTCACCCCTTAATTGAACATAAACTCGTCGGAGTAACTTGGTACTGCCCGAGAAGATCCCGTGGTGATTATAGATGCCGAAGACGACTCGGAGC
ACGAATCTCCAAGTAGTTGAATGGATTCTAGCTCACATTTCTATGTAACCTCCGGTTCCCACATGCTTGCACTGCAGCAAATGCACACATCTAGCCTAAATAAGTACACATATCAACATA
TTTTAGGATCAGTGTACCATCACCCATGTAGGCATATAATAGCCACTAACCAACGCTAGCATATGGGGAGCACAGTTCGCGCCGATCCACAAGATAAAACGCGAGCACCAGCACCACTAG
CATCAGTGGTGATCATCACTTAGCTATTTAGCTTGTGGCATAACCTTTTTATCCTGGAGTATGCACCAGCTTGCTACATCTCCTGCACTCGAGGACACTCGATATTTGTTTCCCTCGGCA
TTCGATTTGTGCACACATGTGACGTGTCTAGGATGTGACAACGATCGATCAGTTTTTTTGAGTCGTTTCACGAGACCAATAAGCGTGGATCGCTTTCATGCCACGCATATTATTCGCGCC
CAAAACTCCCTGCTGATAGCTAGACGACGATGAAACCATTTTTCCTAGTGGAAAAACTTGGAAATCCTTTTCTCCCACGACGAGACGCACGCATGCACACTGCTGGTCTATTTTTGGAGC
TATGGCAATGGCATACTGGTCTGTTTCCGTCAGTTTAGATGAAGGGCTAGCTGATCGAGGCCATCGGCCATTGCCAATGCGAGCGCGGCTGCACGAGCTAATGGGAGGCGTCGGATCAGG
CCATTTGGATCGCGCGACAGAAGGCAGATGCCATTGAGCGGCGGCGACAGATGCGGCAGAGAGGCAGCCAATGGGCAATGGCCGGCGTCAAATCAGCAGGGCTGTGCGGCCTCGCTCGGC
GCTCCAGTTCANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGACACAAAAGCCTGCGGGTGGGCCAATGGCGTCGCCCCACGCCCCGCGCTGCACGGAGATCGCGCCACAGTAAT
CAATCCTCGGCCGCCAATTATTGCAGAGATCAACCACCTACTAGTACTAATGCATGGTTTCTCTCTCTTCACCATAGGCTATAGCGCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCCGATTGGAGTATGTTGGTGGTCTTCCGGATGGAGTAGTCGGCATGCATCAGGTTGGTATTGGAA
CAAGGTGTGGTTCTGACGATCGACGAACTGTGAGTTCTATTCTGCCTTCCTTTGGAACCAGGATTTGAGATCCAAATATGTATTCCAAAACATGGTTATTAAGATCAAACCAATCGGTTC
AGAGTTCCATAATGAAGAGGACCAATAATGGCTGGACCGAAAGAACCACCCAGCTCTGAAGTGCAGTAATCAAACAAGTAAACAGCATGGTCGATGGACACAGCAGGTGATGAGGCCATT
CCTTCAGTCCTTGGAGATTAAGAAAACTATCGCCTCTAAAGTACACAATTCAGTACAGAGGCAAACTAGTCAACTTTGGAGGATTGAGCTAGGCTGTTCATTCCCCTCCCTCCATGGAGG
TTAATTGATCATGGTTTTTGGCCCTCTATTCCCACATTAAAATGGTGAAATTCATTGTGGAAGTGGGATAAAGTCGGTTGACGTTGTTTAGCTAATACTTGACATTGTTTAGCTAATATA
CTCATACGTTGCTTCTTGTATGTTGTGGTGGCATGACAACTCTTGCAACCTACCCGCTGAATTAAATAGCTCTTTTCCTCTTTAATTAGTACTACTGCTATGCAACACAATTTATGTGGT
AGATTTACCTAATAGAGGACTACCAATAATAGACACAGATCCAAGGTAAAGCCCATCCGGTAGAAGAGGAAGTTAGGCACGATACAGATACGAAATATTAATTGCTACACAACTGCTAAA
ACCTTAATGGTAGCAAAAATATGACTACATACCAAACGATCATACTACCTCCAGTCAAGAATAGATGACGTCGCTGGACTAGAACAGGCACTTCATTCCTTAGATGTACATGGGGCTTAA
TTTTCGCATTGATTTCTTAAGAAAATATTAGCTCTAGCAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTAATAATTTTTTAGGGTGGGGGATCCCCACCTGAATTTCATTAAAGGACCTTAGGTATGGCAAAA
CCAATATAAGATTTTTAGTAGGAGAAACACACAAGAGGTTACAACTGAAGTACATCATGAGGAAGAAAAAAAAGACACTCATACTAACACTTTAAAATGACAAGCCCTGAAAGAATAACC
ACCGATCACAGTCATTACTGAACAACATACTCGCCATGTACGTCATGACTATTGCACATTCAGTCCACCCCTTGTAACTATGCCGCTTCGGTGTCACCCTCCATCTGAGGGTCAAGCAAA
CAGAATGGGGACTAAAGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGATGTATTATATGTTAATATTCTTCTCCATGACTGTAGTAAAAACTTACAAAAACTCAGAGAGATCCTAATG
TATGTGAACGGAGGTTAGCCACTTACAAACCTTTATGTGTGGGTTTTTAAGATGTCACTTTGGGCTTAACTTTCGCGGAATTTCTACTCCTACAAACTACATTGTTTTTAGCAGCAGAGG
ATCCTATCAACATTTTTAATTAGGAGCTGCAGCCGTCTGTCTGGTTTGTAGCTCAGGGAAGGTACGGTGCATATGCATGACCCGGTAGTTTTTTCCCCAATATAAAAATTCCACCGGTCG
ATTCCAACCCATCTTTCCCTTTCGCCGAGCTCGCTCGCTCGCTACCCCAGCTAGCTAAACAAAGCGGGGGTTAGTGGGTGGGCGCGCGTGATGCCGCTGCTGCGTCGTAGAAGCAATTTT
CTATCCCCCCTTGAGGATGGCGACCCCCGAGATATCCTATTGACGCTGCGATTAGGGAGAAGCTTAATCGCGCCGTCCGGGGGGTCTTAGTTTAGTTAAATAATTCCATCGCGTCCCGTC
GTCGCACGCTCGGGACTTTTACCTTTGATCATTTCCGGCGTGCCCACTTTTTTTTTTATTACTTACTAGCTTGTATTTTTTTTTTCCTTTTTGCTTCTATGGATCGTCTGGGCCGTCCAG
TAATCATTGTTAATCTGGCCTTGGGGTAAAAATATTGTTGTATGGAGATTTTTTTTTTTGTTGTAAAAGCGTTGAGTTTTAAGAAGCCTCGAGCGAGGTCCAACATGCACGCATCAAACG
CGATGCGTATACGTATGTACGTACGTGTAGCCTATCACTTTATGGGCTTGTGCCGACGACTTCCAAGGACAATCCATGTGGGGTCTGTGGGGGTAGCAGTACGAACGGCGTACGTGCGCC
GTCTGATACATCATGCATGTGCTTAGGTACGTGGACGCGTGATGGCTTGTGGATCTGGACAATCTTTCTCAGCTGTTACGACGCGCACGCATGATGCACACACTCACGCGGCGATACTAC
CTTTATAATAAAGCACATTCGAAAAAAAAATATGATATTGACGGGCACGTCGTCAACAACTGAAAAAATAATGTATTAGGAAAACAGAAACACTCATAGCAGGTAATTCAAGCAGGCATG
TTTCACTAAGCTAGCTCAGTTTTCAAAATATGTAAATTTGACAGATTATCTATCGCGTCACTTTAGCGTGCTCATGTTTTTGTGCTTTTGAGTTCTTGTACAATTCAACTTGAGGTTTAC
ATGTTGATTTTAGAAGTTTCATAGTATACAATCTGGTCAAAAACACTTTGTATGTTCTGGGCATCGTATTATATTTATCATTACAACATGTTTATAAATTGAGTAAATTAAATAGAGGTC
GCCGGAATATTTTTCAAGGCAAATCTACACGTATGGTCTTTATATTTTCAAAAGTCATTAACATTCAAGGTTTCACATACAAGATCTGCTTAGATATCGTCCACAAACATCAGCATATAG
AATAAGAATATTACAAATGCAAGCACCCGTCCTGAGCCTAGGACTCGAATACGGATGTTCTGCCACAAGGAACCACTAAACTAGACTTAATTACTTTGCAAGATATGTGGAAATTTGATG
ATAGCATCTATCGCATCCACTTTTGGCTGCTTGTGTTTTTGCGCTGACAGGTTTCCCTTCTACAGTTCAACTTGAGGGTTGTATGTTGTCGCTTGTTAATTTTCATGATGATCACTCCGT
CGGTGAAAAATATATACTTTGATCTGCTAGACATGCATGGAAAAAAAATTCGTTACAATACATTTCTAGACTGAGTAAATTTATGAGGTCGCGGAAATATTTTTCGAGGCAAATCTACAT
ACGTCATGTTACATGGTTTCAATATTTTCAGAAAGTCATTAATAGTCAAGATTTCACAATATCTGCCGGATCTTGTCCAGAAAAAAGAACAACAGAAAAATATAAATCATCAACTTCTTG
CATGGTGTGTCCTTCGTGCATATAGCTAAAGTAACAGGTGCGCCCCCCATCATACTTGATTTTACTCAAAGAACAACACAACAAAAGAAACATGAGCACGGGGGCGACAATATCTGCTAT
ATGCTTTCTCATAGTACGCGGCATTGAGATGCATGCAGTGAATGCAACGAGGATTTTTATTTCATAAAAAAAAGAGAATGCACGAGGATAATACACCGAGCTAGCTGGCCCTGTCCCTGT
GTACCTTCACATGCACGCAGAGAGGATAGGCCGGTGGGTATAATAGTGGTTGCATGCCGGGAGCAGTACGGCCTGGTTGCATTGCTGCGCTCCTCATCTTTTCCGTTCTTNNNNNNNNNN
NNNNNNNNNNNNNNNNNNATCACCCATGTACCTGCACACTGCAGTAATCCGTCCATTAATGTTGACTCGGCAGTTGCATATGCGTGGCACTTGATTCATCAATCGTGCGGTCCACGACCG
GTCGATCATCTCCTCCTCGCCGTCGGCGAGCTATCCGGTGAGAAGGGAGCTAGAGAACGGTGAGGCGAGGGTAGGTTGGGATCTTCAGGGTGTGAGACTCCGCGCAGGGTCATATTTTGC
GATCACCGTTCAGGAAAAAAAAGAAAAATAAGACAAACTTTCAAACACTACTACAGGCCGCCCATGCTTTCTACTTGTGCTCTCCGTCCGTACACGTGACTCGGTTGTACCGTACAGAAC
CTCCCACAAAGCAGATAGTCGCTACGCGTACACGCGGGCAAATTTTCTTTTGACTGTGGGCCTGGGACGTGATTTTGTCGCATAAGAGTGCTGAGCATTGGTAGTTTCACTTTGTACTGT
CAAATAAAATGCTAAAGGTACAGAAGGAAATCTAAACTACACATATTTTTTTAACTCAGCTAGAGGGTACTTATATAGTTTGTCAACTTAACTGGTTAAACACCACAACCACTACTAGTA
ACAACACTCAAGGGGACCACAAAATTAGATTCCCCGTCATGTGTTTTGTTGGAGTGGCTCTCATGAGAGAACTTCACATGCTACCTTATACGTGCTACAATTATTTAAAAGTTCTGTAGA
TGTATTTGCCCTTTTAAACTAACTGATTATTTTGAGAATTCCATTTACAAATATAAATAAAACATTTTGGTGATGCCTTTTTTTAGGGTGCTAGCATGAGTTAGTGAGGCACAAAATGCT
ACATGTACCAAACAATACCCCTTTATATCTACCACTTGATCCTCGGGAATAGAGAGGTTGTGTTGTTGCTTCCCTCTGGTTGAAAATGTTTTGTCTACGTTGTGAATGGAGGAATTAAGG
AACCACTCAGAGAATTAGTGCATGGTGAAAAGAAGTAAAAAGATGGCAGTGTCCCATGTATTGTGAATCCATTCATATTCGTATACGATGGCTAAAATCAACATCCTTCCGCATGTATTT
TCAATCCTACATATGTATCTAATGGATTTGGGACTCAAGAATTGAAAACAAATGTGCAAAGTGCCTCTAGCCTAGTGGTTAGAATACCTGAGTAGCATCCAACAGGTTGGGTTCGACTCC
CTGTGGGAGCGAATTAAATAGGTCTAGAATAAAAGAAATTAAAGAAGCTTCCCTAGCTGACTTCAGTCAAAAAAGAATTCAAAACAAATAATAATTCATATGTTCCAAATTGTTTACTTA
CAACATATACATTGAGTGTGGTCAACTATTTTTTTATAAGCTATGAAACACAGTTGCTGAGAAATTGATATTTTGTGACACTTGTGCACATTGATATGGAGAGCATTTCATAGACAATTT
AGAGTAAGCACCTTAATGTGGTCTATATATTCTTGAAAAATTGTTTTGCATCATTGTGTCAATTACCCTTTTGATATTTGTCACTAGTTTTGTAATATATAGACTCATGCCACCACTGTG
TAAAATTGGTACAACAATGGCATAGGTGGAACAATTCTTAGTGATGGCATGAGTCTAAATGCTACAAAAATCAATGACCAGTATTACAACTGTAATTGACACAATGGAAAATCTAATTCC
CCATTATTATTCTACTAATAAAAATGCAAACTTAGAAATATGGCCCACTAAAATAAATGGAACATTTAGCTTTTTAGATATGCAATAGATCAGAATACGATGTCAATGTCGACACATATA
CCAAGAACCTATCCACAATCTACATGTCACAAGTTTCTTTAAAAAAAGGGGCCATGAATATATTCATGTTGCCACCTAACATATATTTGTTCGAAAAAGAAAAGTTTGAAAATGATAAAG
TGATAAAATTGAAAAAGATGAGAGACCATAGATGACAATGCAACACGTCATCTCAAGAAAGTGATTTTGGAAGCCAAGATGTCATACTTTGGTAGGAGGCCCACAAATTGATTTCTCTAA
ACTCCAAAAAATGATAAAAGGAATTTTCATTCATTATTCCTGAGTGGGATATCTAACAACAACTATCATCTATGATAGGAGAGGTGTTGGAATGGCCAACACAAGTAATCATAAGACTTG
CAAACCATAAATCATGAGTTCGAGCACTAGTCATGGCATGAAAAAAAGCTTGCTTCACCAATTCTCGTGGAGGTCAGACTTGGACTTGGACAAACTTGATAGGTCTTAGTTTATGTTAAT
ATTGGCCTATACTTGGGCTGGGTTTGTTGCCTAGGTATATACTCCACCACAATTTTAGTGGCCCAACTTAGTACTTACCCAACTCAGGAGTTAGGTGTGCTCATAGCTCTGATAAAATGC
AACGTCACATCCATATAATATGCTACATGTTGAATAGTGCATGGTGACATATAGTATACTAATTATAAAAGATAGATGAGTATCCTTTCCCTCAAAAACATTCAAACTTGATACTATATA
AATTACTCTATGCTAATTGTTGATGATGCATCACGCACATATCTAGTATCAAGGCGATAGATGAGTACAATTTTTCTACAATTCTCAAACGCTATACCGTAGATCATCGTATCATTACTG
TCGAATGAAGCCTCACATAAAAGGATTTATTACTACAGACATAAATGATCCACCATTGATTTTTGCCCCTTAATTATGTTCAAGTATGATACTATACAAATAATTGTGCGCCCCTTACTG
TACGATGCATCTTAAAGATAATATACTGCTAATGTGTAAATGGGAATCTTTTTCCTAGAAATTTCAAATCACATATCGTGTAGATGATTGTGTGCCAGCCGTGAAGCGCCACTTCGCGAC
AAATAATCTAGTGCTACAACGATAAATGAGTATCCTTCTAATATCAAGGTGATAAATGAGTACAATTTTTCTACAACTTTCAAACATTATATCGTAGATCATTGTATCCATACCGTCAAA
TGCCGCATCACATAAAAGGATTTACTACTACAGACATAAATGATCAACCATCGATTTCGCCCCTTAAAAATTTTCGAGTATGATACTATACAAATAATTGTGTGCCTCTTATTATACGAT
GCATATCTTAAAGATAATATACTACTGATGTGACAAACGGGAATCCTTTTCCTAGAACTTTCAAATCAGATACGCGTAGATGATTGTGTGCCAGCCGTGAAGTGCCGCTTTGCGACAAAT
AATCTATTGCTACAACGATAAATGAGTATCCTTTCCTTCAAATCTTCAAATCGGATACCATATAGATCATTTATGTGGACAATAAGATGGCACCCCCTATCGGGCTATAAAAACCGACCT
AAGGGCAAACTTTGTGAAGAACAACGAAGAACAACAATAGGAAGAAAAACCATATTGCTCTATTGGAGATGAAGCAAAGGCTATCGGGGGACTTCCAACTAGGTGCGATCACTAATACTT
ATTTTTCACTCCTTCAAGGATAAATAGAAATCTAAATATACATATAATCCTTAGAAAGGAGGTGCGTTGTGAAATTCTCTTTTCTATATTATATATTTTTTTGAGGAAAATGTTTAAACA
CATTTTGACCACTTTTTTCTCCCAATATTCTAGCACTTCATGAACTTGAGTCTTTTTTTCCTTTTCGAATTTGCGCCTAAAATTGTGGGGATGCACTTACCGGTTCTTCTTCTTTTTTTT
CCTTCTAAAATTCGGGCTTACTTGGACACATAAATTACTTATAAAAGTGTCAAATAGAATACTACTCAAATCTAAGTAGTCAGTGCTGCACGATTCCAATTTGGATTTTCACTTGAGAAA
AAAATTGATACTATTGAAGTATTTTTGCACGATTGGTAATAATTTTTCATGTACATAAAAAGGCAATGGTTAGTGGAAAATAATAGATCGGCCATAGGGAAAGAAGGACGGTGGCATTGC
TGAAGTATTTGCTAAAAGAGGGGACCAAACGTTGGCGCTTTCTCCAATACAATCAACAAGACAACAAAGAGAGAGAGGTAAGAGAGAGAAAGAGAGATCGAAAAAACTTAAATATATACT
AGAGTTGGTGTAGGATAGGACAGGCCCCAGAAAAAATCACTCATTTTCTCGCCTCAGCGCTCCCCCCCCCCCCGGGCTCTCTCTCTCTACCTCCTTTTTCTCACTCTAAAAGCAAATACA
CGCGCTCTCTCCCTCTACCCCTTCTCTCTCCTCGTCTCTCTCCTGCGCTGCTGCTGTTAATGGTACAGCCTTTGGCTTGGTGGAGAACCAGATGCCTTTGATGTGTGAGTGGTTGGTGTT
TCCTTCTCTCTCCTTTAATTTTTTCTCAGCGATTTCTTCTTCACCCCTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTATCTCATCTCTCGTGTGGGACGATGAGAGAGAAA
GTGGTGGTGGGATAGATAGCAAGCCAACAAAATCAGCAGCCCCATTTCTTCCCCTTTTCCTCGTCTACTCTCCTCTTCCTCCCTCCCCCTCCCTCCCCATCTGCTTCCAGTCCCCCAGCC
AGAAATCGAGCCTCCCACCACCACAGGGCTCCGGGAGCTCCTCAACCTCCTCCTCATCTGCTCGCTGCGTGGATCTGCCGGCGGGATGGTCGCCCCCTCACGCGCGCGGCCGTGGGAACG
GGTGTGAAGAAAGGTGAGAGCGGAGAACTCTCCGGTGGTGTTCTTCCGAGTTCTTGCCGTGTGATTTCTTAGGCTGTTCTTGGCTTCCTCTACCTGAATCCGTGGGATTTTTTTCCTGGT
TCTTGCGCGTCGGCTCCCCCTTCTTCTTCTCTCGCCGCCGGTAGACTGGCATCTGCCGACTGGATCTCTCTTCGCCGGGTTGGGAGTTCTCGTATTTCTCTCGCTGCTTGTGAGCTCTAG
ATCTCCGCTGTTTTTGGTTTTGATGCGCGTGTTGTTCTTGGCTACCCGCAAAGATTCTCGATCCCTGCATCTGCTTTCTCTAGATTTGGTGCGGATTAGGCCCCGTGCGGAGCTCCTGTG
CGCCCATGGCTTGTCCTCCTCCAAGCCACGGAAATCCCGATTAGGCCAGCGATTAAGCAGCAGAAATACCTTCCTTTTCTAGACTTCTCTCTATATTTCTCGTTAATACGCTCCCTTTCC
TCTTTTTCTTCTTTCGCTATTTATTTCCCCATCAAGAAAGCACTACCATACAAGCTACCCTCCAGTGCTTGGTGACTGTTCATGTCTCGTGCACTGCTACTCCCTTTCTGCGAATCCTTT
GCGAGAGCTGCATGATCCGTGTTGGCTTCTCCTTAATCTGCTCCTGGACTAGCATCTCCACTTGTTGCCGTGGGATGATATTTCATGTGCTTCGAGCTAATCTGAGATCAGCTTCCTCCC
GGCCTCTTCTCTCCTTCCTCCCATCCGTATCTCTCCTGCAGCATCTATCTACATAAAATCATGCTGTTAGATTCCCCAAGAACATCTCGTTTGATGTGTGGACATGAAATAACATGGGGC
TTGGTTTCTCTCTGCAGGTGCCTGATGAGGTAGTGGGCGGCCAAGGAAGCAAAGTTTCTTGCTCTCCACCAGTTGAACTTACCAACTTGGTATGCTGGAGTGCAAGGATAAGAGCAGGCC
CAATTGCTTCACAGCTCTTGGGTTCTTGGTGCGGACTGTAGCAGCAGCAGATCTGGGGGGAGCACCGAAGGCGTTCATCAGATGTTATCCAGTGAGCACCCTTCAGGCCCCTCATGTTCC
TCCAAGTCTGCTGGCCTGGGTGTGAGCGCTGATCCGGCGACGTCCGCGGCGGGGGAGCCGGCGAGCCAGGATCCCAGAGATCTGGTCCAACCGTATCCCAAGTTCTCCATAAGGTGAGAG
AGATACATGTATACCTTTGATTCAGTACCTTGGGAGATGGATTATTTTCGGTGCTTAACTTCTTGATGATGGTCTCTGTCTTTCTGATGCGTCGATTAATAATTGGGTGCTGCTTTGAGG
GGTCGGATTGGGTATGAATGGTTGCTTTCAGGGTTAATCCGTGTTATTGTCTTGGGGTGTTTAATTAGTTTAATTTTCTGTTGATTAATATAAAAAGGTAGCCCTTTTTTTCACCCCCAG
AATCTGAAAATAAAAGGATGCTCCTTTGATGAATCTTTGTCCACTGCCTGCTATTGTTTTTCTTTTCCATACTTGGTGGTTCTGCAATAAACAGGCAGGCGACATATTTTTGGAGATTTC
AGTTTTGATATGACAGCATGTTCAGTAGGACCATGTTGATGTTGTATTTCTCTCTTCTTTTCAACATATTGCGGATGGTTTGAATCTTATACAGTGCGGCAACACTATACATGGAGTGTT
CATCATCTTGGCACGTATTAGCATATGCTAATGGGTCCATGTTTCTGTCCCTATTTTTCAGAGATTATGTTTTTGCTTCAAGGAGCAAAGGCGTCAAGAGAAGCTGGCCTTTCCATCCAC
ACTCGTTGCAGCTTTGCCTGAAGCGTGGTGTTAAAGATCCACTGCCTCCATTTGAGCCTCCCGATTTGATCCGGTCACAACCATTAAGTACTTTCACAGACGTTGAGCAATCTGCTGCGT
GTTCAGAAGCCATTGCTAGTGTTAGTCTGGTGAAGACTAGAGATGCTGGTTCGTCAAATGAGGATACAAGTGATATCAACTTCCAATCATGCCAACCAGTAGATGAGTCATTTGGACCTT
CACCATACACATCACCGGAGGATGGGAAATCTGGTATCGACCAAGTGGGGAGTACAAACGGATCAGACCATACTGATGAGGCTGTACCTATAGATCTGCAAGATAATAGCTCTACAAAAG
CAAGTCGAACTGAGGTTGCTGTGCCCTCGTGGCGGTTGAGAAATCTTGGTTCATCGTGTGAGCCATCTGAAAAGAAGTGCAAGTTTGTAGTCAAGTTAGGCACCCCGACAGATATTCGCC
GGACGGAAGACATAGCATCTAACTCTAGCTCAGTTTCAGATCCAATGGCATCAAAGACTTGTCCTGTTTGCAAAGTGTTCGCTTCCACTTCGAACACCACATTGAATGCCCACATAGATC
AATGCCTTTCTGCTGAATCTAATACTGAGCTTGTTGAAACAGTCCTTGTGAAACCTAAAGTGAAGCCAAGGAAGAAGCGATTGCTGGAGGACATATACAAGACCGCCCTTCCATACACTC
TTGAGGATCTTGACCGGAGAAATGGCACTAATTGGGCAGTTGAGTTGGCTATGTCCACAGTGAGCAAAGAGGTTTGCACTGAGAACCAAAGCCCAGAAGTGGCACCATTTGACCGAAGAG
ATGATGAAAAAGAAGGAGATGTCTATGTTGATTCTAATGGAATAAAAATTAGAATTTTGTCCAAGTGTAGTGATGGACCTTTGGTGTTGAGGGATGATGATTCAAGGAAAGTTGCGAAGC
ATGAGACTGGAAAATGCATACTGATGAGCAAAAAGATACCAAAGTCGAAAATGTTGAAGAATAAGAAGCTCAAGATGCATAGAAAGAAGTACAACAAAACAAACCATTTGAACTCCCAGG
TATTGTCTTTTAACTTGCTCTACAGTTTGTTTTTCACTCTTAAATTCATTACCGTGCTTACTGACTGGGATGATGTAATCATGCACCGTTATTCCATGGAGTGCATACTCATTATTTCCC
AGGCCTCTTAGACTGCAGTTCATAACGTTTGGACATATGTGGCTATATCTTTTATAAACTTGCTACATATTATGTCTCGTTTTAACTCCACGTGTCAAAAGATTTGTAAGAACAGAGATT
AGACTTGAATTTGCTGTTGTTAACTCCCAAATGGATTTGCAAGATTATGGAATTCATTACTTAATTACTACTAAACCCTTTGTTTCATTGAAGATAACAGTGGCTATGGCATTTTACTGA
AAAACACTTTCAGGTCTTGGAGGCAATATCCTTTAAAATTTAATTTTGGTGAACTGAGTTGAGTTCTGTACGAGTTAATTTACATTTGATATTAGTTTAAAGATGCCACGTTTTTAGGTG
GATGTGAAGATATTTCTTGTTTTGTTAGGTGTAAAATGTTACTTGATTGCATATGATAATAGTTTGTTCTTCCGTCGATCTCATTGAATTGTTTTTTATTCTGCACCTTTGATTTATTGT
TGTGAGATATGTAGGTTCCAGCATACTCACATGACGATATCAATGAGGAAACCTCTGAGGAGGAGCGGCATTCGCGGAATCCTTCTGGAAGCACCAGCAATTGTGGTTCTGTGACTATGA
GGCAGTGGGCGTGCTCCAAACGCTCAGATATTACCAAGAATTTTAGCAGAAAGTTTAGTGATAAAGTGGCATCTGGAGCACAGAAATCAGATAGGAGCAGCATGCTTGGCTTTAATGATT
CCCAAATTACAGAAAGTCCTGCTGGGGTGTTTTCTTCTGAGTCACCAGAAGACATGGCCACTACCTCAGAAGCCATTGGCTTTGAACAGAGCAATGCAAGATTGCTCGGATCAATTCCTA
CATGGTCGTCAAAGACCCCTCTGCAGAGTGGCATCGTGCCAAAAGTACCTAGATCAGCTGCAGCTCTTGCAAAGAGGAAAATTAAGGAGATTGGAAGGAGAGAAGCTAATAAGCTAGATA
ATTATGATATAGAGAGGAATCCCTCCTCAGCTAAAAGATCTGAAGCTAGGAGTCTTTCCTTCTCCACTGCAGGGCCAAGCAATGGACCAAACAGGTTAGTGCCTACATCTAAGAAGATCC
GGAAGCACCGATCTATGTTGAGGACTGGCAAGCGTGCATTTTCATCTTCTAGTAGTAGGCTCGTTCATGGTTTTGGCCGAGATCACGAACCTGACACCGGACATGTAAATAAGAAATTCA
GAGTTTCTAATAATGAGGGCCCCAAGAAGTTTGTGAAGCACACAGAAGAGGATACAGCGGATAATGACTCCTCTTTTGGAACTGACATGCCAGAATCAGGACAGCAGGATGATCAGTATG
ATGTGCCACAAGAAACAGAGGGTACACAAATGTATTATGAAGGTGAAGAACCTGAAACTGATGTACCATATGATTCAACATCCAGAAGTAATCCTGTTGACTGTCAAATAAGCGATGGTT
CCCTGAGTCCTGAAAATAACAGATCAGCAGGTAATGTTTTAGTTGAAGGCTACAGTGTAGCTGTGGAGGATCCAAGCTCCAGTGAGCAATTAGCACATCATGGCCAGGAGTCCAACAGTG
TTGTCAATAATGAGACGGAGGAATGGCAGATAGATCCGGCTTCAACAAAGGAATCTAGTGCCTGCTTGACTAATAACAGGGACATGGGTCCTGGAGCTCCTCAGGATAACTCATCAATAA
CGTCAAATAGAGAAGACTCTAACCAAGAGCAGGGTTTGCCACTCGGACGGGACTCGCTGGATTCTCCTATTTCAACTGCATCAACCATGTCTCCTCCAGCTGCTTTGAAGGATTCAAGGA
TGAACGAATCAGAACCAGGTCCTTCTACTGGTAGAACTGTTGAAGAGCGAACCACTGGGAGCTTAAATCAAGAAAACAAGTCTATACCTATAGCAAGAGAAGGTGAACAGATGCCCAATG
AAAAGCCTTTCCGTTGTTCTTGTCAGGAGAATATTGCCAGGGATTCTAATCAAAGTGCTGTAGTCAGACCTCCAATGCTGAATTTTACTGGAAAGCAGGTTCCACAGTTGCACATTGGTT
TAAGGGCATCATCATGTTTCAGCACATACCAAAGAACCAGCACAAAGCCCAACCCTTGCTTGGATACACATGATCATCCATTAGCAGCTAAGGTGTCAGCTGAATCTGCTATGAACCTCC
CATCTTACACAGCAGATTGTATGAGCCCCGCATTACAAAATCAGCTTCCTTCACCATCAAATCCTATCTTGAGGCTGATGGGTAAGAATTTGATGGTGATGAACAATGAAGAGAGTGTGC
ATCCTCAGCCACCAAGTTCAGACTATATGTTGAGGGGGAATTATGTGGCGCCTGTTGGTTTTGTGCCTCCGAAATACCAACATCTCAGTAATTCAGCGTTTATCAACACACCCCCAACCA
CAGCAAGTCACCAAATGCCTCTACCAAGTGTTCAGGCTGGCAGCTTTGTTGGTCCTCCATTGCATGGTGGTTCAGTGATGCAATCTGACCATCATGCGCTGCAGAAGGCCTACAGAAACA
TTGTGCCAGTCATGCATCATCCAAATTACATGATGAAAGAAGTGATTGTGATTGATGATTCTCCCGAACACAGAAGTGAGCCACAAGTTAGCATGCTTCTCCCCCATGCCCCATCTCCAG
CAACAATGCCCACACCAAACACTATGCCACCCCAGCCATTTTACTGCCTTCCATCACAAAGCCCAATTTTGCCAAGGGATAGGGCTGTTGGATCCATGCCTGTATACGCAAATGTTGGCT
CAATGGTTGGTGTCGGATCATCAAGTCAAGGAAGCCAAACAGAAGTAGCCAATCCTTACATGCAAAATCCATTCTTCGCGCAGTCTGCAACTGGTTACTTAAACCAGCCAATGTACTATT
CACAGAATCTGCGGCGATAGTTTCTCAGTAACTCAATGACCAGGAGAACTCCATTTAGCTTGCTGGTCATCACTGTCAAAGTGGGGGAATGAGAGTTTTGTGATGGGTCTAAAATGCTGA
GATTAGTGAACCTGCATGAGGATTTTCGCATAGGTTGCTTCTTTAGTTTTTTCCCCCTTAAAGGTAAACATGTTTGCCATCAAAAGTATTTTAATTACATCCTGCAAAGTTGCAGTAAAT
TATAGTATGCAATTCCCAACAGTTCCCCAAAGGAATATATCTCAGTATTTATCGAAGAAGCTAACACCTTATATTCCCAATAGCATGTTTTCTTTTTCTTGGATGTTCTTTTCCTTTCCA
CTCTGCTCTGTGAATGGTTGCTCATCAGTTTATTACGAGCGTTGATAGTTGATGTAAGACTGAAATGGTTCGCTGCATCATACAAGAAAACTGCCTGGAGTATCTTGCATGGATGCGTAA
CGTGTTGAAAAGTTTTTTTTTCCTGATGAACCAAAATCTGTATTATTGCAAATTGTATAAATCAACTTTGAAGCTTTCCATATCCTTCATGAGGCCAGTTGTTAGGTGGAAAAGATACTT
TGATTTGCTCTTCAAAAGACTCTTGGATATGGCAGTAAATTTCAGTGCTACCACAACTGTGAGAACCTTGGGTTATGTATTGTTTCATCATTCATTGTGTCCGGTAGCCTCTTCTGATAG
CGTTACCTGTAGAATTTGAACACTCGATGATTTTATCAAGATCATCTTAACAACGAGTAACCACATGTGATACTAGAGAACATAAGCCCAGCAGAGCGGTTGCAATCTCTGAAAAGGCGC
TTCTTTTGCTTGCTAGGGCTATGCCGATCGATCTTCACTGTAACTGATGTGATACGCCCTTCATGTTTAGCCCCGAACAAGAATGCGTCCCATTCCTTTTAGGTTAGACAGGTTTTGAAT
CTTCTGATGGCTTTGGTGCGTTTGTTCTTTGGATGTTTTCACAGGTTGAAATCACGAAACGGCCTGCTAATTCATCAGTGATGTAAAAGGTTCTGTCCATTGCTGTCTGCTCGAAACCAG
GCCTCCCTTGTTGCCCGTACCCTTTAGAACACCGACCCCGAAACCAGGCTCCTCCACCTTCGTCGCCGATGGGGTCGAGATCGAGCTCGAGCATCACGGTGGTAACGGCGGCGGCCCAAG
CTTCGACGCTTCTAAGCATCCTCTAAGCCTTCATCTCAGAACTGGTTATAGTAGAAAAAAAATGGCGGGGAACGAGAGGTTGGGAGCAGCTAAGAGCGACAGAGTAAAAAAAAAAATAGC
AGCAGCAGCAGCAGCAAGCCGAAGAGCGCTGTAGCAATTAGCTCAGCGAAGTGACGGCTGTTGCTGCAGCGCGGGGAGCGACAGTGGCAGAGCCCTTTTTTTCTCATTCTTGGCCTGCTC
CACATCCTCCGGCAGCAGCGTCGCCCAGTACCAGTACGGCGCCAATGAATGGATCGGAACAGCCGGAGTGGCGGGGCAGAGCGAGAGCCGAGAGAGAGAATGACAGATCGATCTGGCCGG
CGATCAAGAGGTCGAGACCGTGGCTGCTGGCTGGCCTGCCGGACAGGGCCGGCGTGCGATCGATCTAGCGAGCGAGGCGCCCGACGGCCGACGCCGGCGCCGCCTCAGTCCTCACCCACC
GTGCCGGCGAGGCCGCGCTGCGTTCGGCTCCGGGTCCGGTGAAGGAGCAGCAGGAGCAGGAGCCAGCTGCCCCAGCCCCGTCGGCAACCCCGACCGTCCCCAACCGCAGCAGCAAGCACG
CAAGCAGGTGCCCCACGGCTTCCGTGGTTTTCAGCCGAGACGGATGGTCCCCGACTAAGGTAGATGCCTACAGCGAGCGGGCCCCGTACCAGCAGCAGCCACGCCATGATGAGCCGCGGC
TAGCTGTTGGCTGCCGCCCGTACGCCGCGCTCCACCACTCCACGTCTCCACCCCGCATTTCGTATTGCCACTCCTAATAAAGGGCTCGATCTGTCTCTCTCTAGATCTCGGCACAGCGAT
CCATTCCTGTCGACCTCTCTCCTCTGTTGGATGAACCATGTGAGTCGGGTCGATGTGGGGCTTTTCCCTTGGTTGTGAGTGAAACAGTGGACCAATCCATCCTGCAGGCAAAGGGAGGGA
GGCCGGCGGGGAAAGGGGGAACGAACGATGCATTGTTGCTTTATAGCCACCATGCATGCCACGTCAGGCGCCATGATCTTTTACTTTCCAGCTCGTATATTTTTTTCCCCCCTGCTATAA
TAAAACTCGCATCTTGTTTTGGGTTTCTACTTCTACCCGGATGTATTGTTGGACTGCTACTGCAAATGCAGTGGCGTGCTGTGCTCTACTACGTACGATTACTCCTGTACTAGGAGTTAG
GAGAGGAAGGAAGCACTGCAGAGCAGAGGCTCTGCGTCCTAAAAGGGTGGCAGGGCGCCTTCATGGTAGGCAGAACAGTGCCCCGTCCAAGCAAGTGGTTTACCTCGCCTCGGATGCCAC
GGTAGCTAGCGGCCGGTGAGCAGCGCGCCACCAACCGGTTACCGGCCCGTGCCTCTGCTGCGACGGGGTGTGTTTGTTTCGGCCAGGCACGAGGACGCTCGATTGAGACTTGGTTTCTTT
TTTTTTTTCTCGACGGCGAGGGCATGCGGCGCTGGTGCCTGGTTACACGCGTACAACGGCAGGTTGCTTCCCTTCCGTGGGTTGCTGTGTTGTGTGTGTGTTTCCCACAGCCCCCGTAAG
GCCCGCGCATAAAGGAATCTTCCTGCACATATGTTGTACCACGTCAGTGATCTGCTTACCCCCTTTCTCCTTTATTGCGGCCCTACACTTACCGCTTTTGAATATTCCTTCTGCGCTTTT
CTTTTTGCTAGGAAAATGCCCCTGTGTTTGGCTATGCTTTTCGAAAACCAAGTTGCAGGAGGAGGTACCATATGATTCCGAAGTCACATTCTTATCAACGGATTAAGCAGGTGATGAACA
GATTCCTTTGTTGCCATCAACTGTAAAAAGAACTTCGGTAAAGCACGGCCCAAAGAGAAAAGGCACCGCACGGCCTTTTTATCTACTCTCTCGCTGTCCATCATACGGGTCTCAGATGGG
CCGGAGCCCACGCTGGATCAAGCCGCGGCCCACGCACGACAACATGGGACCGAATCCCCGGCGTCATCCGTGGCGTTGGTTGACAAACTAACTAATCAAATCCTTGTTCTTCCTTGGCGG
ACATCCTTTCCTTCCTCGGGGCATCGTTCCGTGCTTTCCTCAACCTTCCCCTCTTCCGTGGCGCGCAGTTTCTCCGCCGCCTCACGGAAATTCCCCCCGGGGTTCATAAATATTCGCCGC
CGCAGCAGGCGGACCCGGTTGTCGTTGTTGTCTCCCATCATCATCCGCCACCGTTGCGGCGTCCCGTTTCCAGGAACTTTCCTTGCGTCAGGTGCGTGATTTCTCTCCGCCCGCCCTAGC
TTCGTACACTTTTATTCCGGAATTTTCAATGAAAGTTTTTGGTTCGTTGCAGCCGAGGTCTGCGGCTTGTAGTGTAGTTTCTCGGAATTTTGTTCGGCGGGTTGGTTAGGATAATTGTTG
GAGGATGAATCGGGCGCAGCAAGGATGGGAGGGACGGGGACCTATAAATGCCCTGCGTTTGTGTTTGAGGAATCATATAGAACCAAACATTTCATTTCAGAATCGTGTGCCTCTCTATCC
TGTAGGGCTGAGGTAATTCGAGTGAAATCAGGATGGTTGTATTGGAGTCTGTGACTGGGGCACAGGATTTTGGCCAGTTGCCTCTAGAGCCACCTCTTGCTTCTTCTCTTGTCGAGATGA
ATTGGGGCAAGGTAACTCAACCTGGTGCTGCAAGTGTGCAGTTAGCCGAGCTGCGCTTTATGGATATCGAAACAGCTAGCCTGGGTCGTGGCGTTGGGAGGGAGAATATTATCCTACTGC
TTCCGGAGTTACCTTTCGATGGGAAGGCCGGGCTAGTACCCAAATTAGCTCTACCATGGCTGGTGTCGCAAGATAAGTGCTTTGTTCAAACATCGCCGAGGAAATGTTCTGCACTAAGGA
GATGGAGAAGAGTAAGGAGGCAATCACGCGACAACCCGCTGCAGCTTAACATCGACTTTTTGGTGCTAGCGACGGGCTATTCGCTAGGGATAATAGGTCCGAAGACAATTGGGGATTGTA
ATAGGGAAAGGGTTAGAGTGAAGGGTTTCGGTGTTGCAGGAAAAGGGCGCAAGGCGCACCGTAGAGCGATTAGGGGCAAGAGACATGGTTCCCTTGTTAAATCTTGCTTGGTAGCATCTG
ATGCAGGTGATGCTTTCAGCAGCTACAGGCTGTTGATGAACTATGATGGCGGTTATAATAGGAAAAGGGTTAGGGTGAAGGATTTTGGTGTTGCAGGAAAAGGGCGCAAGGCACACAGAA
GAGCTTTTAGGGAGAAGAGACATGCTTCCTTTGTTGAATCTTACTTGACAGCATCTGGTGCAGGTGATGCTTTCAGCAGCTACAGGCATAGAACAATGTTGTTGAACTATGATGGGGATA
GAAGTGAGGACCGGCAAAGTGAGGAGGTTCAGTCAGCATACAGGAGAGACAGTGACATTGGCGAGGAAATGGTAATAAGCGAGGAGCAAAACGATGAAAATGAATGGAGCTGGGTGAATC
AAGATAAAGATGGCGATCCTCTAGCGGAATCAGTTTCTTCACTTCATACGACACAACAAGTCCTTGCAAGTGGTAAAAATTCTTCTCTTTGTTCAGGTTTTTCTCATGCCCTCTGTTTTA
AGATTTGCTTTGTACACTGATCAGCAATTCAGTAGGTGCTTTCTTCTTTTGGCCTATGCAGTTCTTCTCAGCCATCTTAGATAATGTGTGATGGCTTAGATGTTTAGAATTTTTGTTCCA
CGAATACTGCTCTAATATGTTGTTGGGATATTGAAGACTTGAATTTCTTGGAGCTCTGGCTGCTATAATTTGTCCCACAACATCTTCCTTTATAGGAAGCCAAAAAATCTGTTACCTTTT
ATCAAGTATGTATGCTGCCAATGCAGTAGGTGCTTTCTTAAATTTTGGCCCATGCAGTACTTTTCAGGCATAGATAATGTGTGATGGCTTGGTTGTTTAAAATTTTTGTTTAAGGGATAC
TGGTTAATATGTTGTTGGGAACTTGAAGAATTGACTTTCTTTGAGCTCTGACTGCTATAAATTGTCCCAGATATCTTCCTTTTTAGGAGGCCAAAAAAATTGTTGTCTTTTATCAAATAC
ACGCCTGCCGCACTAGTTCATTCATGCATTCACTAATGTAAGGACAAAACATATAGTTTGCCCACTTATATGCGATGCTATTTTTGGTCAAACCTCCCCTTTATAATGCCATCGTGTCTT
GCTTGGTGCTGCATTGATGCAGTACCCATATCCACTTCTGGAAGTGTTCGTTTTGCTAGTTCCCGTTCTGATGGGTCGATTAGCTCTGTCAGTTATTGGTTATAAGAAAGTTGTGACATC
CCAGTTCTTGTCAATTATTCTTTCGTAGGTACCACTTATTGGCTGCATCTTTTAAATTATTTTCAGCCTTTGAGGTTTGACCTTTAGTTTATGTTTATGTTAACCACCTCTTTTTTTTTT
GTCTGTGATGTATAGAGATACAAAAATTGTCAGAGCTTGGCAAAGAACTTGAGGCAGAGGAATCCACTTCTGGAAACAAAGACCAAGATGTGATCGTTCTGCCATATGCACATGTTGGTA
TGTTAGAACTGAATGAAAAGATGGAGCACCTCGAGCAGAAACTGAAAGAAGCGTCAAACACCATCCGAGAGAAAGACTTGAGGCTATCCAAGCTTCAGGTACTCATCAGTACCGCGGACA
GGCCAACGCTGGAGGAGGAGGAGGCCGCCAGCATCGACCAGCTGGTGACGGAACTCGAGGACCACCTGCAGGAGAAACTGGAAGCCGAAATCCAGTGCCTGGTGATGATGGAAGCGAGGC
AGAACTGGCAGGTCCGGACGGAGGACCGCGCCGCCCTGGAGGAGCACAGGGCGTCCGCCGGGGACAACAGCAGCAGCAGCGCGAGGATGCTGCGCAAGCTACGGGAGACGGAGAGCAAGA
TCGTGACGCTGAAGGAGCAGGTGGACAGGCTGGAGGTCCACGAGAAGGAGCTCTACCGGGCGACCGAGGCCCTGAGGATGCAGAGCAGGACCTTCAAGGTGTCCCTGTTCGGCCTCGTCC
AGCTCATAATGCTGTGCCTCTCCCTGAAGGTGTTCTTCGCCTGGGTGCCCGCTCCGTTCGACGAGGTCGTGCCAACATGATTCGGGTTCAGCAGTGTTCTCTACTTCTCTTCAGCCTGTG
TGATGATATCTTAACGTCTCACCTCTTACGGCAGTCAGTAGGTGCTAGGTGGTAGAGGTTCGTTACACTGAAGTGCTGCAGGTTGTGGTGATGTACATCAGAAACTAAACTACGCGTGTT
CTGTAAGATAGTACTAGGTCTGTGCCTAAATTGGGTGATTGACTAGTCGGGTGACTGACGGTTAGCAGCTAGCCAGCTACTGAAAGGTGCCAGCTTCAGTTCGTCTCGAGCTCTACTTGT
GTTTGATAAATGAAACGCTTGGTTAATGCCCCAAACTACAATTCTACAAGTAGTGGTGGTGGAGTTGAGGCTTTTTGATGCGTTGGTTCACTGCCCAGTGTGCAAAAACTCTTTACACAC
TTGGGCCCGTACACATCTTGCAGGCCTACGGAATGGAGGAACAAGGGCCCATGGTTTAAATGAGCCCACTGTTATCTCCCCACACCACCCCCTGAGCTGCTGGGCCGAGCGAGCTTTGCT
CTCAGAACGTGTACCAGAGTTCAGCCCAGCAACACTACCGTTCCCGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAGGTCAGACGTGGTGGATGCGCCATGCG
CGTTGGCGCACGGCCGGCCCCTCGCCTGCGGGCGCTCGCTCGCGCTCGACCTGTGTGGGAGGCGCGGTCCGCCGGGCTCGATGGGCTCGCTCAACGTCGTCACGCGTCGGCAGCCTCGCC
TCGCGTCGTGACGTGATTCCCACTCCCGGCGTCGTACCGTTCCAGTGCCACGGATCTCGGCACCCGCGAACGGGAAATCCACGCGCCGGCGCAAGTCGGTCGTCTGGTCTGGTATGATCT
CGCGGACATTATTTTCACGGTTGGGGGTGACCTGGGTTCCCGTGTAGATTCTGGACAGCTGGACAGCTGGTAGGAGCAGGCGAGATTGTGGCCTTCTGGCTGGTTAACGGACTTGGTCAC
TGCAATGACCCGATGCCGATGCCACAGATTCGCCGATGCCTGATGCAATGCAGGTTTGGTGCGCAAGGGAAGCCAATGGTTTGCTTGTTCTTGGCTAAGCTTCTAGCTGCTGTCCCTTTA
AAAAAAAAACCTTTAAAAAAAAAAATCTAGCTACTCAGCTAGCCAACATGGCAACATTGTTACGGTGTTTGCCGGAGGACGTGATAGTGATGCATATGCATCCTTGTAACACGAGTTGTA
TGAAACTCAAGAAGTCCTGTGTTTCAACTGTTTTAGCAATCGCATTTATTTTCTTAGCTGAAAAAAAAAACGTAATCCTGACTGCTAAGTAGTACTACTAGCATGGAGAAAAATAGTCAT
GGACAGGAACTATAGCAGGAGCTCGCTACATAACCGCTGCAAGAAAGTAAGAAACTAACACAGATAATATGCTCGAGAAGAAATAGTAAGGCAGCCTTCCTCACAAAAATGAAACAGAAA
TGTCTACTGTAAATGATAGAGAAAACCAACTGTAGTTTGATCTCAGAATTCCTCACGCCCTAGTGCTACATTTGTCCCAACAGGAACCTGATTGTTCAGTCTCAGTAGCTGGTACATCAG
AATTTCAAACATTTTACCTGCTACATAAAAAGATTACAAGATACGACTCCGAGCTCATGTGTTACGAAGCAAGATCACAAAGAAATGGCAATGGAACACTGCCAACTCCTGACTGACACA
CTACACGCTAGGACAAAATTCAGTGACGATATGCTTCCTGTGATATCCCTTCAAAACTGACGCTGCTTCCTGTGATATATCCCTCCAAAATTGACGCTGCTTCGTCCTTCAGCAGCACGG
ATTCCAAAGCAAGACCAATGTTCCAACTTCCAAGGGTAGCTAGGGCTGATTGTTCTCACCTTCACCCTCCTCGGGCAGCTCGTTCAGGTCGAAGTCCCGCGCTGCTGGCTCGGCCGGCGC
AGGCGCTGGCGCTGATAGCTCGGCCGGCGCGGCTGCTTTGGCCTGATGCTTCTCCGGGAACCAGTGCTTCCTCTTGTGGCCACCGAGCGCCTGGCCGGTGGGGAACGTCATGTGGCACTC
GGAGCACACGTGCGGCGCCGCGCTCTGTGCTACCGCCGGGGTCGGCGGCTGGACGTCCTGGACGTGGAGGTCCAGGCCCCAGCCCGCCCCCGCGCCACCGCCGGCGGTGATGAAGACGCC
GCCGCCGCTCAGGCTGCGGTGCGCCAGGATGTTGTGCATCGCCTGGGCCGCGACGAGGTCGTCGTGCCGCGCGGCGTCCTTGCCCTTCACGTGGCTGGACATGTGGCCGCCTAGGGCTTG
GTAGGTGGGGAACGACTTGCCGCAGGTCGGGCACCCGTGCTTCTTGTCCGACGCCGGCGACGGTATGCGCCAAACCGCCGGCTTGCCGTCGGCGCCTTCCGGTGGTGCAGGCGATGATGC
CGCCGTCTGCTCGAGGTCCGGGGCGGCCCGACGCTTCTTGGCCTTCTTGGCGCCGGCGCCGCTGGAGCCAGGGCTGGGGGCGATGGCGGACTTGTTCGCAGGGACCACGACCAGGACAGC
TTCTGTGGTAATCTCCAGGTTCGTGGGCTCCTTGACCGCCGGTGTCTGGGACTCCGCGCTGACCTCGAGGACAATCTCCGGTTGAACGATCTGCTCGGCCTCCGGCGGCGTCTGGTTCCC
GGCGACATGATCGACAACCATAGGCTCCTCGACATCCGGCATCTGGTGCCCAGAGGCGGCGTCGGGGGCATGCACAGCCTGTTGCACCGACTCCTGCTGGGTTTCGGACGTCGTCGAGTG
GCTGGAGGAGGCCAACCCCAAGAGGATCATCGCGGCCTCCTCGTCCTCGCTGCAGCTGCTCGCCTGCTTCCCCGCCTCGAGCGCGCGCTCGCCGCTGGGCGCCAACGGCGCGCGCCCGCG
CTTCGCCGTGACTGGCCACTTGGTCGAGAGCTCGGCCTCCTCCCACGGCTTCTTTCCCCCAGCCGTCGCAGCAGCGGCCGTCATGTTCATCGCCGACACGTCAGCGTCCTTCCGCGCCTC
CTGCTTCTTCGACTTCTTGTCTCCGGCCACGGCGGCGGCGGCGCTGGCCGTCGCCGGACGGATCGCCCCCTTGTAGCCCCTCTCTGGGTGCTTTCTCAAGTGCCCGAACATAGCCTTCTC
CGACGCGAACCACTTGGGGCACTCCGGACACTTGGTAGGCTCCGCGTTGCCGACGCCCATCGGAGCAACACCATTGCCTTGGCACGGCGCCGGCGGCGCGTCAGCAGTGCCTTGGGCCTC
GTCGAGCTCCAGCAGCAGAGCCTTCGGGGTTGGTGGCTCCAGCGCGTCGTCATCGACGGCATGAACTGGAGGCGCCTCTGCCGCCGCCTTGGCAGCCTGGAGCTGGAACTGGTAAGCTCG
CGAGTTCATGAGGTCGCTGCTGATCAGACTCAGAGAGGAGTTATGGTGCTGCGGCCTTCAGTTGGGTGGCCGTATCCGTTTCAACGCGCCGGGCAGATTGAACCTTCACATTCCTTGATG
CTAAAAGCTAGTAACCGAAACAGAGACTGGAAACCAAGAGTCCCCCCATGCATGCATCCGAGAACTAGTCCTTTCTCACCTGGAAAAGAAAGAATAATGTAAAGTGAGAAGAATCAGCAA
TCAGATGAGAACATAGCCTATAGTACAATAATGGTCACTGAGTGAGTTTGTTTCAAACACAGCTAGCACAGATAGATACTAGAATGAACTTAAAAAAGCAAAGCAAATGCATTGGATCAA
TTTTAAGTTGGTAAAAGTAACATGAAATAATGGGCAAGATGTAACAAGGAAGTAGTACACGTCCAGCATTAATCTTTTCCAATTACAAAACAACCCAAAAAGAAGAACCAAAATAACCTA
CAGTACACTAGTATGTGAATCAGTAAAAGTAGTTGTAGGCGTATAGGTAGCTACTGCAAAGGTTCACCTACTTGAAGTGGAGTAAACAAGAGTGAGATCATGCATGCAGTACAAGCGGTG
GTAGAAAAGGGAAAATTCCATGTACTGGAATGGCAGGAGATCTTGCAGCCTTTGTATCCTCTTTCCTGCCAAAAGAGTACCGGAAGCCCAGAGATACCAACTACCTGAAGTGCACTGCTA
CTCCAGGCACTGCCTGCACTACCACTGGGGAAAGAAAAAGCAACGATTCTTTTGCAGTAAAACAGAAGAAACTGAACGATTTGCACTGCACTATAGCAGTAGCACCCTACTGAAGTAGTA
GTAGTAGCAATCGAAGGCTTGGATCTGCATCCCAAGCACTACTGGATAATTGCAAACGGAAGGAGATCAGTAAAAAAACAAAGGAATGAAGCATTCATTAATTAGCAGTGGAGGCATAGA
GATATTTCTTCCCAAAGTTAAAAGGAAAGCAAACCGGGCCGCACAGATAGGAATGAGCGAGCTGGAAATCAAGCGCAAATTAGGAAAGAAATCATTCGGACTGGGGTGGAGAAAAACAGA
TCCGGCAGGCAACGAAAATCAACCCGCATTGGGGCGACGCGGCGGCGAGCTCATACGAAAAAGTAGAAGACGAGCTGACGAACAGATGGGTCTGAAACCAGAAACCCCACCTTGGAAAAA
GAAAAAAAAAGGGGGATGGAGCTGAAAAGGAACGACCGGACTGGCGCAGCACAAGACGATCTCGACGGCGACCCAAACAAAAGGGGATCAAAATCTCGCGGCTGCTAAAACCCCATGAAC
TCCGAGGAGCGGCAGCAGCCCTAGTTGTACTAGAGCATCATCTATCACCGAAGGAGGGTGAAATAGGACAGGAGGGCAGGCAAAGCGAAACCCAAATCTCGCCCAAATCCCAAGAACAAA
GCTGCCTTGCAGGTCGTAACCGAACGAACCAGTATACTACTACGCGCACGACGAGCAAGAACCCACCGCCGCAGCTGGAATAAACGATCGCTATTCCAAGGGATTAAATAAAAAAAAATC
AGCAAGGAGGCAGCATGCCGCGCTGATAGGAGGAAGGGCCAAAGTAATCGATCCACACACGCAAACGAACGGAACGAACACAAATCATCAAAGCGACCGACCGAAACATGAGATAGATAC
GCATGGCAGATTCGGCGTCGTTCCAGACCCTCGCGCCCACCGCACCTCCCCGCAAAACCTAGCCCCAGCTACCGGCGGGGACGACGAGGAGGAGGTACGGCGGTGCTCACCATGACCGAT
CAGGTACGAACGGTGTTCGTCTTTCTAGGACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCGGTCTCACCTCAGGAGCAGGGAGCTGGAA
CAGCGGCGGGGGAGCGAGCGAGCCAGATGGAGCTGGCTCATCCAGTGCCTCCTCCGATCCCTTTATTTGTAACCGCCAGGATCCTGCAGGAGCAACAAGGAAGCTAAAGAGGAGGGAGGG
GGAGCGGAGGCGAGGTGGGTGGAGGCTCAGTTGGCAACTCTCACGCACGCACCTATCAGGTGTGGCTATCACCTATTCACCTCACCTCACCTGAGTGGGGCCTAGCCTANNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNTAGTAGTAGTATCGTATCTCCCAGACCCCGCGCTTGTGTGGGGGGAAGAAGGGCGGAGTAGGAACGCGCGCCGCAATGGGAGGGAGAGGGTGGGGA
GATCGGACGGCGGGGCCGGCGCCCCGGAGGAATCGGTGGCGTACGGACGTGCAAGCGAAGGTGAAAGTGAAACAAACTCCATCCCCGTACAGTACTGGCCTGCCTGATAACCGTGATCGA
TGCGCTTGCTTTTGTGTTACTCACCGCGCCGGGTTTTTGCCGATATCTTTTCAGATATTTTCGTGTTTTTCTTACAGTGGGAGTAGTTTTATCTTTGAACACCTCCCGCCCCCTTCTGGT
TCTAGAAGCTGAGCCGTACGTGCTCTCCGCGCTGGGTTAGCGATCGCGGCAGTACGCTTTGAGGTGAGCGTATGCCATTACCGATGGTCCGTTCAGTTTTGTTGTAGCAGCAGTGGCGAT
GATCGAGCAAACATGCATCGCATCCATCATGCGATTGGATCCACTCAACACAAAAACAATTGTAATGTGTTCCGTGCAAAAACCACAAGTAGCACATTATTGCTACTTGCTACTGTTACG
CGAAAGTATGCCAAACCACCACCAAAACTAGGAACTCCCCGGAGAAGATCGAGGAGGTGGGGGTTAGGGTTTTTCGAGCGAGGTAGTGTTCTCCACCAAATCGAGAGCTACCCATTTCTA
GGTGGTTAGCGATGGACAACAGGGGTAATGCGAGTAGTGGTGAGGCAGCTGCGGCTGCCAATAGCGAGGCAAGGCAGTGGCACCACGACGAGACGATGGTGATGGAGGGAAGGGAGGTGG
TCATGAGACGAGGGAAGTCGAAGCGCCAGTCGTTACACCTATGACTACTGGGTGGTCACGTGATAGAAAAAGGCAAGATGCATAAGGAGGGAGGGTTACGTGAGTATGATCCATCATGAT
ACTAGATCTACCTTGTATCTTAGTCCTTGCTTTATTTGCATGGTGCTAATATAAGTCTAGTGTAGCCTTCCTTAACCTTCCCGTACAAGATCCACGTGTTTGGTCCATACTATCCCTGAA
GGTTATTAAGTGCAGTGTGATATCGTTACGCTTTTGAAGAAAGAGGGGGAGGGGGGAGTTTGTCTCCCTTACCAAACGTAGCCTCACCGACAAGGCTTTGTCGGAATTTGGGAACACGAA
CAACCAAACGTGTGTGCTCTTTCATATATGGAGAGTATAGTTTTCTACCTAGCATAATACTATTGGAGGAAGAAAAAAATCATTTATGTATCTATATATAACAGTCTGGGAAAATAAAAA
TGAATGCCTTCCATATTTACTTAAAAATGATTGTGGCGTTGGTCTTATTCTTATATGATCCAACTATGAACCATTATAATTAGCTGGCTAATTATTGGGGTTCCAAGTGACCAAGTTAGA
TTTACAAATTTGATCCAGGATTTAAACCCTTCCATTTTTAGGTTCCAAAACATTCATGTACCATAAAAGGCACACAGGAAGAATCATACCTCATTTGCATAGTCTTTAGACGTGTCCATT
GGTTCATCAAGCGACGAGTAAGGACAATAGGTGGAGGGGTGTTCATAAGGTGCAAAGGAGGAACACAGGATGGAAGGCGTGCCAAATAGGGTGGAATTGGGCAAAGATGGGTGGTAGTCC
GCTAGAATATGCACGAGGAGGCATGAGGGTGTGAGGGCGTATAAGACATTTGGTGAAGGTGATGCCGTTGGAGATTGGACCTTATAAGGTATTGGGCAAAGATGGGCTAAATAACGATTA
TGCATAAGGGGTTACTCTTTGAATTTGGGGATTCTGTTGCAACGGGGAGGAGGAAAATCTGGAATATAATTCTAGAGTCATGAGCTGAATGGCACGTCACAGAATTGTATGAGCAGCTTG
ATGGAAACGAATCAGAAAGTGCTAATTGTGCTAGCAGTACACTACATGTTATTTGTAAAGTAATTAATGTATGTTCTAATAAATCCATGTGGATATGCACGAAAAAGAAAAGAAATGAAT
ATTTCTTTTTTTTCAATCGCACGAAAACGGAAAACAACAACTAAGCACCAAGAAAAATAAAACAATGTAAGTTTGTTGGACTAAGCAGATTTGGGCCGGGCCTGCGGACATTGGCCTTGG
CCTGCAGTTACATTCCGAATGTCAGTGATGATCCACGAACAATGCAGCGGTGCACCGTCCACGTGTCCTAAAACTCTACAGCCTTACTACTCTTCTAGCTGGTTTTGTACGGGAGGGAGA
GTGGCACCATAAACGTGCTAGCGCCGTCCAGATGGCCTGGACGGACAAACAATCCCGGCGAGTGGTTAAGAAGCTTACAGGTCGGTCCAGGAAAGGCCGTCCAGATGGGCCTGGACGGAC
AAACAATCCCGGCGAGTGGTTAAGAAGCTTACAGGTCCGTCCAGGGGGAAAAAAAAAGTTCTCCACTAGCGGAACCATATGCCAAATGATTTGCTTGTACCTTTCAGTACGCGAGTAAGT
AGTTTCTTCGGGAAAGATCGGGGAGACTCTGCTACTCGGCTTTTTTGGAGCGTGAAGGATCATTATTCTTGTCTGGACAAATATGACTTAGAGATACGACGTGGCTTCAATTAACCAGTG
CTGAAAAATACCATTTCATACGGTCGACGATTGTACCGTTTGATCTACATCATGCGGTGTTGCTTCTTCTTGATTACTAGTCATGGGCACTTGTTCTTCGTCCACTATGATTCTTCCTCG
CGTGCACACTTGCTTACGCCCGGAGTCCGTGAAGGATCCCGGCAACACCTCGCTACAACTAACCCGCGCATGCTCACACTGCCAAATGGGAAAATCCTCAACCTCAGCCTCAACAATACT
AGAAGCTGTGTATTATTAAAGTTACGGTCAGACGTATCCGAAAATCTCGGACCTAAACATCCATTCGTTCTCACTCAAACTTGGTTTCTTATGTGTCAGTGTGTGAGAGTCTGAGATTTC
TTATGATTTGAACGTGGGCTTATTTTAGATTTGTTTTGATTTGAACATCACGTATTGGTTGGCGAGGCTGAATGATTTGGTGGTAATCACATCAGGACGCAGTTGGAGGAGCCAATCGGA
AGCAGGGTCAAACACTCAAACTTGGGTACAGATACCTACACCGTCCTTTTCAGAGGAAGACATTCACAAATCACAAGAAGGGGAAAGAAAAAAAAGAAATGCTGCTACTATAAGATCCTC
CCAACACACGCCATTCCCCCCTCGAGTGATCTAGCCGGCCACCACTCGCCAGGTGCTCTTCAAATAGCCGCCCCGGCAGGTCAGAGGCACAACCAACTAGTCCCCCTCACCAAGCGTTCG
CTCCTCCGATCCGCAACCGCGGAGGATTTGGTAGCAGGCGGAGACCGGTGCCGGCCCGCGCGCTCAACCCCGTCGTCCGCCCCGGCGATCCATGGCGCTCGGCGAAGGCGGGGATGACCA
CCACGGGGCCGCCGCCGCGCCCCTCATCGCGCACCACGAGAAGCATGACGGCGGCATCGTCCGGAGCGGTGAGCCGATCGATCCTCTGCTCGCACTCGCTACTGCCGATTGCATACCGCC
TGCCGCATTCGAATTCGATTAGGCCACTCCGCGACTGAAAATCGGCCGGTGAATCATTCTCACCAGGGAGCATGTGGACGGCGGCGGCGCACGTGATCACGGCGGTGATCGGGTCCGGCG
TGCTGTCGCTGGCGTGGAGCATCGCGCAGCTGGGGTGGGTGGCCGGGCCGGCGGCCATGCTCGCCTTCGCGGGCGTGACGGCGCTGCAGTCCACGCTCTTCGCCGACTGCTACCGGTCGC
CGGACCCCGAGCACGGCCCGCACCGCAACCGCACCTACGCCGGCGCCGTCGACCGTAACCTAGGTACGCCGTCCTGCCCGCCCCACGGGGACCACCATCTTCTCTTTTCGTTTTCGTTTT
CGTTGCCTCCCCCCGGTCCTCGTCTTTTCTGTTCTGCCTTTTGTTTTAGAAGATGAGTCTAGTGCTGCTCCAGTTTCTTAGAAATGGGCGTTTGACTGCTCGTGTATCTTCGGCGCGAAT
TAAGGATCGATGGGTGGCAGAACAAGCCGGATCGTTCGGAACTACCAGAACTAGCTGACTGCTGACATGTGTTCGGTTCGGGTTTAAGAGGTTCATCATTACTGTTAGAGGCAACAGAAA
CATGCGGTACATGTGACTGATTGAAAATGTGCCAAAAACCCCATAACAACTCAAATGCAGGATAGGCTGGAGCAGCAGGCTAAACCCACCACCAGATTTTTTTTCCCTTTATTTTTTTAA
AACACCACCGGAAATTCTCCAATGTTGTTTTTTGCACTTTTTTAAGGCAATTTTTAAGGCAACGTTTTGCACTAACACTCACAGGCCACACAAGGTTAACCTGGCCAAACAACACCCTCA
TGTTTCCGAGCATATAAAGAAATAGTCGGTCAAGGCAAACTACATGTGCCGGGGCGAGCAAAGATTACCTTGGCGTTCGCTTCGCTTCCTCATACGAGGAAACTCGTAGCTGCCCGCAAG
AAAGGAAGAACCCACGAGACACGAGTTATCTCTCTCCGATTGGCGCGACGTAGCTGTCAAATTCGACTGGACGCGATGGCGAAATGCGGAGCGGATAGAGACGGAAACAGACAACCAGAA
GAGAAGGCTCGCGAACCCCGTGGAGGGAAAGGCCGGGCTTGTTTGGATGGAATCCTGGACCAGGCAGCGATCCTGACCCTGGCGTACAAAATTAAACGCTGGATGAGTTGCCTGGCTCAG
ACAGATTTCACAGGACTCGATCCAAGCGCAGCTCGGCCAGGCTCGTGTGGCTGGCAGAGGCTCAAGAGGGAACACGTCAGCGAAAAGGACCCACCCGCGCGTTCCAACTCGAACTCCTCC
CCGCTGATCAGCGGTGGCTGGCTGGTCGAGTTGGCCGTTCGGAGCCGGCAGGAGCGTAGGCGACACCTGGCTTCCGAGACGAGAGTGAGTGGCTGAGTGGTTGACTGCTGAGTACTGACA
GGTGAGGAGCGGTGGCGATCCATGTGTTCGAGTCCGACACGACTGATGAGCCGCTTTCCGGGCTCCCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGTGGCAGTGAGGCTTCGACCTGGATGGTCCAGCGTACTCGTCGG
CCGGGCCATCTTGAAGGCGACCTTGGCTTTACTAGAGTAGCATTTGCCACGGCATCGATCAGAGCAGTTGTTTCTGAACAATGGCGCATTCGGCCGATTCTCAGTTACGAAGCCGTAGGA
GGTTAACTACTTAACTAGGCAATAGAAAGAAAAAATATCACAGGAACAAATTATACACTGGCAAAGAGGACCTACCCATCACTGTCGATTACAGTGTTGTAGCAGGGGCCAAGGGTTTAG
GTGTACCAACGATGAAAGCGCTTGGTGTGAACCGACGCATCTGGAGTTCATCTTGACCTGACAAGTGTCGAATACTAATGCTGTCACAATCTCCCTCCATGTTCAGAATTCGTGTTCCTC
TTGTTTTCCTCTCCCTTCTCGAGGCACATGATTGGCTGCACTGTGCATCGGATGATACTTGCATGAACCACAAGGATATGTAGGCGCAAGTTAATAATTAAAACCGTTCAAAAAAATGTT
AATAATTAAAACTATTTCCTGTTTACTAATTACTAGTACATCGTATGCGATGGCTGTTCGATTCTGATTTCTGAACGGCCAAACGCCATTTTGAGTTTTGACAGGTAGCAGCAGCTCGTG
GGTGTGCATGCTTCTGCAGCACACGGCCCTGTTCGGCTACGGCATCGCCTACACCATCACGGCCTCCATCAGCTGCAGGTACGACTCCTCTTACATCCCCTCCTGTACTGTGCCCAAACA
TGCTGCGTGTGCTTTTTGGCAAGACCACACCCTCTAGCAGTAGTGCTTGTACATGCTAGTACACGTCGACACCGTGTGGTTCTGTGGTGCTGGGCTGCTTGGCGTTGCCGGATCGGCGGT
GGTGCCCAGAGCCGCGCGGCCGGCAGGGACTGACTGTCATTTCCGCTGCGAGTGTTTTGGCACAACGGGCCGATCCCACACGTGGGCCAACAGCCCAAGTAGGCTCGTTCTACTCTGTAG
GCCTTGGGCCCGCGCCCACCCTGGACAAGTGATGCAATTTCACCTGTAGGCCTTGGGTTGGGTACAATGGTCAATTAGTCATGTACACGCCTTCTGCTAAAAAAAAAAGCTTATGCCCTC
GCCCAACATCCAGCATTGCTGATGTCTGGGCCTTGCTTGGGTCCAAGAAACAATTAGCCCACCTTCATCAAGTCCACGAAAAGTCACTGAATTTGAACTTCCCTCCTCGCATTTTCTTTA
GCAAATAATGTTTACTAGAAAATCTAAACTGATCTACAAACAATTTAGAACGGAGGAAGTATGTAAAAGTTAAATAAACAAATGTTCAGATCTCACTAGGGTCCCATCATGACTACCATG
GTCACTTCATGGCTGCATCGCTAGCGTTGTTATGTTCTCCGGTTCCAGATTAATGGTCGTTTTCTCCGCATATCATTTCCAATCTGAGAGGAAAAACACAACACACGCACACAGCTTGTC
TCCATGTTGTCGTCACGGTCCGTCTGACGGGTAGCGAGCTAAGAAATGCGTCGTCGCTGTTGAGAAGCTAGCGACGGGGAGTAGTTTTCTTGAGCTGCGCGCGAGAGGACTAGCGAGTCA
AAAAGGCAGCTCCAAGAGCGCGACTTCGAGTTCCACCTTTTGACCTGCAAACGATTCTCTATACGTGCCCACAGTAGTTTCTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTAGTTGGTTT
TTTACTGCATACGCATGTATCCCACTGGACAGGTTGAAATTTTAGTCGATACGGAACGATGATGTTGCCACCATTTCGATCCAATATGGAGCTGAGTACGCCGTAGCGTCATGCATCTAA
ATCTCGCCCCCGCATGGTCCGCTCAGGGTGACTCGGGCAGCCACCCCATCCACCACCCCCAGCCCTCATTCCCCTCCCTCCCTGCCTCCGCCGCCGCCAAAGCTGCCCTGTCCGAAGCCG
GGCAAGCAGCGAGGAAGGCGGTGGCAGGGCCACCTTGCTCCTTCCTCTCACCCAGGCCCCTTCTTCCTCCCCCTCTAGTTTTTGCTCCGGCGGCAGCGCCATGTCTGACGGCCAGATCCT
CCTCAGGGAAGGCCGGACCGTGTGTTTGGACGCCGAATCTGTGCTCTGCTGGGTCTGACGGTGGCGTGCTCCCTGCATGCCGACGCGGGGCTGCTCCTCTTGGCGTGGCCTGGCGTCCGC
TAGCTGGCGCGGCACGGCGGCGTCAGAGGCGTCTGCGAATGGCGCGATCCGGTAGTGGCGCTAGTGTCAGTGGCTGGCTCGGCCCCGCGTCACGAAGGCGGCGACGTGTAGCTGGCGGCA
GCCGGATTGGACGGAGTGGCGGCTGGTCACGGGAGCGGAGGAGATGTGCGGTGGGGCAAGGAAACGGCCGTGAGAGATGCGTCCGGGAGGAGGCCGCGCGTGCGCGGAGGAGGCCCTGAC
CCATCCCGGCAAGCGACGGTGGCGGTCCGGGTGTGACGGCGGGCGCGGCGGAGGCCCCAACGCGGGGGAAAGAGACCCCGCGCAGCAGCAGCAGCCTAACAGAGAAGGAGACGTGGAGGG
GCTGCCAAGAGGAGGAGACGCGGAGGAGGCATTGGAGGAGGAGACGCGGAGGAGGTGCGGCGGTTGGTGGCGGCCCACGGAGGATGGCGGTGCGGAGATGGTGCCAGCACGGAGAAGGAT
GGCTGCCGACGAGAGAGTGGTGGTGGAGGTACAGCGGCGTGATGCGAGGAGGTGCGGTGGCAACGCCGCCTCGGATGGACTGCCTTGACTGTGGCCGGGAGTGCCGAGCCGTGAGTGTGC
AGGGGTTGGGATGCTTCGGGCGAAAGCCCTCGCCGGCGTTCTCATTGGTGGAGATGACGGTGGCGCCCTAGGGTGTCGAACTCCCCGCTGGGGGCATCATTTCTGAGCTACAACCCTGCT
GCATGGGGTCCTGTAGGTGAAAACCCTATCCAGATTCTAGACGAGCGACGGCGGCACCATTGGCGTTGTGCCCTCCTTTGAGGCGTCGTCTCTAAAGGCCCATCTCGGTCTGTGGCATTC
CTGATCCATTAGTCATGGACGGCCACAACTGGTGGCGACAATTCTGCCGAGTGGCAAGCTAGACGGGTATTGACGAGGCCACGTGGACGCGATCGCACTTATGGTGCCGGCCAGGGGTTG
TCGCATGGTTGTCGGTTTTGGCCGCTTGCAGCGGACCACAGCGGCTGTCGTTGCTTGACAACGGTCAGTGCGGCGTGGGATTGCGTCGAAGGACGGCGCTTGCAGCAACGACATCGTGGG
ACAACTAGGCTTGCAGCGGACCGCGGCGGGTTGCTCAACTTGGCTGGACTACCTGGTGCGGTACATCATCGGAAGACGACGCAAGCGACTTCTCTAGCTTGCTAACATGGTGGTGGATGC
TTTTGCACGGGTGAAGCAATGAGGTGAAGTCGACCTGCGGCGCCGGCTTGGCTAATCGACGAAGATCTTGTGGAGCGAGGCAACATTGCTCACTACTCTGACAGCGATAAAAGAAACGGA
TCCGGGACGTGGAGTACTATGGCGGGTGTGGCGAGACCCCGCACGTGGTGTTTCTTCGAGGCGACGAGAGTGATGTGAAGTCCAACGGCGGATGTGGCGAGACCCCCGCGCGTTGTGTTA
TAGCGATGGCGATTGCGAGGCAGCCTGCGAGAGGTCCGAATTCAGTGGTATCACTTTATCAGGTGAAGTGTGGTGTTGTAGCGGTACTACAACGGAGGGTCCCGTATAGCGGTGGCCTTC
TCGGTGTGGTGTAGTCTGTTTCTATCAGTTCCTGTCGACGTCGGGCCACGCCTGGAGGTTTCAGCGAATTATGAGCGTGGATGTTAGTGGGTGCCGTTGAGGCGAGCGGAGTGGTGAGGT
CGCGTTGATATCCCAATCCAACCGATAGGGTGTAGCAGTTTTTGAGTTGAGTGGCTACCCTTGTTGATGTCCCAATCTAACTGGACGAGTATGNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNAGTCCAGAACTCCTCGCTACCCGGTCGGTAAAAGAAAAAAATACACGTAGCGTCAGGAGGGCAATATGGATTTTGGCTGGAGTGGCCAATTGCCAAGAGG
GAATCAAAATGGTCCAAATTGTCTGCAGATTAAAGGGTGACAGAAAAAACCTCCATGATAATAACAACTCCACGATATCGTCAGGCAATGGCAACTAACAAACAAGTCAAAAAAAAAAGG
GGGAGATGCTCGGTCGCCGGTCTTTGGAACCGAAATGTTTTGGAAGTTCTTGCTGCATAGGCAGTCTGCCCAAAAGTTACTGAAATACTCCTGTACGAGTTGTATGCTAGTTGCTACATT
AGGTCTCCGAGAGTGCCCTGATGAGGACCTAGACTGCTGCAGTGTTGCCAATTACAGTAAGCTCTACTTGCGCCAAAAGTCTCCTGTTACCGTTGCGGCCAAATGAGGAAGTGTTTTCCA
GCAGCATGCCAACTCGATGCGCCAATAAAAAAGAAAACCATTCTTGTTCCACTCCACATGCAGCGCGCCAATGCCTTCAATGTGCAAACACGTCGTTTTCCCTTAGCTTGATTCAGAACA
TTGCTACAGTACTACTTTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNGGAGCGGGCGCTATAGATGTCAATTTCGCCGTGGTCGTACGGAGCAGGTGGCGAGCTCCCAGTTACGTGTACTCCTCCTCCGGAAGGAGATTCTGGCCGCGAATGAT
AGGTGATGGCCTGATGGGGCTGGGTCACCCAGTTGCCCGGGCGGAAGCCGCACCATGTCGTGGCAAACAAAAGTCGGGACCGTGCCGCGCCATCCGTGCTCTTCTAGCTGTAGCGTCCGT
AGCCATGTCCCTGATGAGACCCTGACCCGTCGACGGCCGGGGGTCCCGCCCCGGCCGGTGGACATCCCCCCCACCCCCACCCACGCCCTGCCGACTCGTGACATGGTACTGTGGCCTGTG
TCTGTCTCTCCTCTCCATGTGAGGGACTGAGGGTGCAATGCATTTGCTCGTGCTCGTGCATGGGTAATTTCCGTGGCAGCCCATTTAGCTGTTCAACTTCGTGCGTCAGATACTACCAGA
ACAACAAACGAGAAACTGCAGGTACTGTTGCAGCTCCAGATTTCCGTCCCTAACGAAGTCCTGGACCGTGACTTGCAGCAGCCTATGCGTTTCACCATCAATTTCATATTTCCATCCACC
CATTTAGCCCAAGTCCCGGACCGTGACTTGGCACAGCGGATCACGCACGTGCTTACTTTCCACAGCAGCCGGCCGGATCGCCAGTTCGCCTTCGCCACCCCGTGAGGTTGCACGGCGCTA
CGGCGCATCCGATCCGGCCCCCCGCCAGTCCAGATCGGACGAAAATGGCGCGCCGCAGCAATGATAATCCCCGGCTCGAGCAGCAGTCAGTCAGAGAGGATCGCCGCGCGCATACGGCCA
TCCCGGCTATACGGTGACGCCGGTCTGACCAGCCCGTCCCATGCACTGGGTTGCTACTTGCTACTCCAGTTGAAGCTCCACCCGCACTGACCAGTTGAGTCCCAAACTCCCAAGCGAGAG
CTGCCGAGCTTGCTGCAGACGCTCCCGGCCGGCCAGATCAACCGAAGCTAGCCGCCGAGCGGCACCTGCGATGGCCGTGCGCCACTCCCTCGAGGTGGCCGACGACCGCTGCGACGACGA
CGGGCACCGCCCGCGCCGTGCCGGCACGGCGTGGACGTGCGCGGCGCACATCATCACGGCGGTGATCGGCTCCGGGGTGCTGTCTCTGGCGTGGAGCGTGGCGCAGCTGGGCTGGGTCGT
CGGCCCCGCCTGCATGTTCTGCTTCGCGCTCGTCACCTACGTCTCCGCTGCGCTGCTCGCCGACTGCTACCGCCGCGGCGACCCGGAGAAGGGCCCCAGGAACCGCTCCTACGTGGACGC
CGTCCGCGCCTACCTCGGTATAGTCAGCACCACTCGTTATTACAGCAAGCGCAGCTAACAGCGAGAAGCTATGACTATGTGCGAGAGAGAAACTTGCGTATCGATTGAATAACTAGCTTT
GTGCCGGTGTTGTTTCATGGTGGCCTTGGCTTAATACTCCGTGTACTCTGTGTGTGTGCTGCCAACGTGCTCAGGCAAGAAGCACACCTGGGCTTGCGGCTCGCTGCAGTACGTGAGCCT
GTACGGCTGCGGCGTCGCCTATACCATCACCACCGCCACTAGCATAAGGTAGCTAGCCGCGCCGCCGGTAACAAAATTTTCCTTTCCTTTCCTTTTTTTTTTTGCGCACACCTTTACCTC
TCTGTCACTGTCATCGTGCTTCCTGTCTGTGTATGTCGAGCAGAGCAGGGCTCTGATGCTAACTGTTTTCATCGTGCTGCTGCTGGTCAATTTCGCTGATTTGTTTTGACCCTGACTGCG
TGTGTGTGTGCGCTTGTGTGTGTTCTGCGTCGGGTGGCTCTTTTTTCTGATTGCTGCAGGGCGATCCTCAAGGCCAACTGCTACCACGACCACGGCCACGACGCGCCCTGCGACTATGGC
GGCAGCTACTACATGCTCGTCTTCGGCGCCGCGCAGCTCTTCCTCTCCTTCATACCGGACTTCCACGACATGGCGTGGCTCTCCGTCGTCGCTGCCGTCATGTCCTTCTCCTACGCCTTC
ATCGGCCTCGGCCTCGGCATGGCCACCACCATCTGTAAGCACCTTTTTATTTAACTAACTAATCCAATCTGTCCATCGTTTGAGTTGAGTGCTACTGGTTGTATAGAAAAGGAGTTACGT
GTAGTTTCCTTCAGACATCCGAACTGAGAAGTTATGTACTTTGCAGTTAAACATTTAGAGGGTCCTATGAATGCTTGACATCAGACAAGCTTTACTGACTTGTTTCTGTTCTTCAGCTAA
CGGGAGAATCAAAGGAAGCGTAACAGGTGTTCCGATGAGGACGCCTATGCAGAAGATTTGGCGCGTCTCGCAGGCCATCGGCGACATAGCGTTCGCATACCCATACTCCTTGATCCTACT
GGAAATACAGGTAAACAGTTTAAGACTAGCAGCACGCTATGCTTTCAGAATTATACTACTCAAAAGTTCATGCCTAGAGCTCAGTTATTAGCGATTCAGTATCTGTATTAAGCACATTGA
AAAACTATTTCATTGCCTCTGTTAATTTAGGACACCCTGAAGTCCCCGCCGGCCGAGAACAAGACGATGAAGAGGGCGTCGATGATCTCGATCCTCGTCACGACGTTCTTCTACCTCTGC
TGCGGCTGCTTCGGCTACGCCGCCTTCGGGAGCGACGCGCCGGGCAACCTCCTCACCGGCTTCGGCTTCTACGAGCCCTACTGGCTCATCGACTTCGCCAACGCCTGCATCATACTCCAC
CTGCTGGGCGGGTACCAGGTACACACCAACAGCCAGCCAAGGGGGCTCCAGAAGTTCAGAATCACAGAATGAGATCCTGAAACACTGTTGCATGTCTGAAAACCAAAACCTTCTTCAGGT
GTACAGCCAGCCCATCTTCCAGTTCGCGGACAGGTTCTTCGCGGAGCGGTTCCCGGACAGCGGGTTCGTGAACGATTTCCACACGATGCGGGTGCCGTGCCTGCCGCCGTGGCGGGTGAA
CCTGCTGCGGGTGTGCTTCCGGACGGTGTACGTGGCGTCCACGACGGCGGTGGCCGTGGCGTTCCCCTACTTCAACGAGGTGCTGGCCCTGCTGGGCGCGCTCAACTTCTGGCCGCTGGC
CATCTACTTCCCCGTCGAGATGTACTTCATCCAGCGGAACGTGCCCCGGTGGTCCGCGCGGTGGGTCGTCCTGCAGACCTTCAGCGTCGTCTGCCTCCTCGTCAGCGCCTTCGCCCTCGT
CGGCTCCATCGAGGGGCTCGTCACCCAGAAGCTGGGATAGGACTGGTCACTGGTGTCCTCCATCTCTGTTTTGGATTGGATTGTGTTTCTTCTTCCGGTTGTGATGGTAATGGAGAATGC
AGCGAATGGGGAGGTGGTGTTTGTCTCCTTGGGATGATGATGAACAGGAGCAGCATACTAGTAGCAGGTCATCTGCAGCCTGCAGGACCAGGGAGTGGCAGGTTTTGCGCAGTGTCTTGT
TCTGTGCCGTGCACCTGCATCAGAGTGGAACATGTACACAGTGTCAGAGTGGCAGAGTGCATACATGTCATGTTGATATTGCCGATACTTCAGAAGTTCAGAAGAATGGGAAGAACCTGT
ATGCTGCCGATGTATTTTTTCAGAGTTTCATGATGCTGTGGACTGATCAGTAGACTGTTCTCATTATAAACTCAGAACCCGGCCCCCACACAATTTGCATCTCTCGGTTTTGCATGGTTG
TCTGAGATTCTGAGCATGCATAAGCCATTAAGCCGTGCATGCATTCTCGTATGACTGATTTTTACTGAAAAATGTGGGAAAGACAATACGTTCGGTGTCGCCGTCTCTATGTATGTAGTT
CTAGAGTTTAAGATCTGCGGGCTGCTCAGTGCGCTCTCATTGTTTTTTTCTCAAAAGACAATGTGCTCTCATTATAACTTGCTAGCTCTGAATTTGCATCATTGCATGGTCATTTGAGCA
CGCACAAGCCGTGCACCTTGCTTTTTACTGAACCAGTGGGAAAGAACATGATCCGATGTTGTTCTTGAAGTTGCAATGCCCTTGGACACCGTGTTCTTCATGACAGTGATGGCAGGATAA
AGTAGCATCATCATCGCAAGAGTGTAATCGAAGTGCAGCGCATAGAAATATCGCTGAATATACTACAATCCTCTGCTACGGTGCAGCATAGTTTATCTGAACGAACTGCGTTGTTCTTAC
AGTACAGGCACTAGTGTTAATCTTGAAGAGGATTAGCAGTACCGTTAGTTTAGCACTGCAGAGTTCACTCCGTTTCACTTTGCCAATTGCACCGCTGGACCCTAGAACACCAGCACGAAA
GCCATTGCCAATTTGACCGCTGCCTTGACTGACGGAGGTGAAAGAGCTGATGATCCTTGCACGCACGCCCTCGGCACGGTGCTTTGTTCTCCCAGGAAGTACGTTGCCAATGCCACCCCA
TCCGCGGCGTCGATTAGCGCCGGGAGCCGACCGATCAGACGACGCCGAGGAGAACAGGAGAAGAAGGGAACGCGCCGGGCGCCGGGCGACGAGGGCTCTGCTGCTTGGACCGGGGGTTGA
CCCGGCGCTGTACGGGTGGGCAACCTGTCCCTGCTCCCGGGGGCGCCGTCACGCGTTGCGCGGGCGTTGAATTCTTTATGCCGCTCATGCCTCCTTNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTATTTATGCGCCCGGCGCCCGAGGTGAGCGCCACACACTTGAACACTCACCATCGTCAG
AACCAGCATCGCAGCAGGGTCGTGCAACGCGGGCTCGAAGTATCATCGGCGTCGTCAGGGGGGTGCACTACCGGAAGCGGCGGCGGCGGCGGCGGAGATGGGGCGCGTCCCGTGCTGCGA
GAAGGACAACGTGAAGCGCGGACAGTGGACGCCGGAGGAGGACAACAAGCTGCTCTCCTACATCACGCAGTACGGCACGCGCAACTGGCGCCTCATCCCCAAAAACGCCGGGCTGCAGCG
GTGCGGCAAGAGCTGCCGCCTCCGGTGGACCAACTACCTCCGGCCCGACCTCAAGCACGGCGAGTTCACGGACGCCGAGGAGCAGACCATCATCAAGCTGCACTCCGTCGTCGGCAACCG
GTGGTCGGTCATCGCCGCGCAGCTCCCCGGGCGGACCGACAACGACGTCAAGAACCACTGGAACACCAAGCTCAAGAAGAAGCTGTCCGGGATGGGCATCGACCCCGTCACGCACAAGTC
CTTCTCCCACCTCATGGCCGAGATCGCGACCACGCTGGCCCCGCCGCAGGTCGCGCACCTCGCCGAGGCCGCGCTGGGCTGCTTCAAGGACGAGATGCTCCACCTCCTCACCAAGAAGCG
CCCCACCGACTTCCCCTCGCCCGCCGTGCCGCCCAACATCTCCATGGACGGCGCTGCCGCCGCGGGGATCGGCGCGCCCTGCGGCTTCCCCGCCGCGCCGCCGCAGCAGGCCGACGACAC
CATCGAGCGCATCAAGCTGGGCCTGTCCCGCGCCATCATGAGCGAGCCCGGCGCCGGCGCTTGCGCGCCCACTGACAAGCAGCAGCAGCAGCCCTGGGCACCGGCCGACATGCCCGAGGG
GCTGGCGGGGATGTACGCCGCGTTCAACCCCGCCGCGCACGGGCAGGACGAGTTCCGGTACGACACCGGGGCGGTGCCGGACTACGTCCTCGGCGGCAGCGGCGGCGAGGCGGACCAGGG
CACGTCGATGTGGAGCCACCAGAGCTTGTACAGCGGGAGCTCGGGCACCGATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCCGACATGTCCGGCCTGTTCGGATCCGACTGTGTACTCTGGGACTTGCCTGATGAGCTGACCAATCACATGGT
GTAACTAATATCAAGATCAAAGAACAGCATTTTCAGGATTAAACTGAAATGAAGAAGTAACCGAGCAAAATATGCTGAAAAAAAGAGAGGGAGTTATAAACTTAGAATAAGGAGTATGAA
AATCATGTATATTTTGCCACGTGAAAAAGGAGAATGTGCATATATAGAACAGAGGAGTTTTATTTGGAGTCCTCTGTTGCAGGGGGTAATTGACAGTTCCAATTCAAACAAATTGTTTAG
TTCGTTTCAACTGTGGTTGTCTGGTTATTTTACAAAGTTCATTCCCAAGTTTTTCGATTTTCTTCTGCACAAAAAAGTTTTTCTATTTTCTCATTTTTAATTTTTTATTTATGTGAATTC
ATTTTATTAGTATTTGCTCAACTATGCAGAGAGCCCAGCCCAAGAGCATCCGAAAATTCTACGATTGGGCCTACTTTTCCAATCCCTCTCTCTCTGATCAGATGGCCATCTCGTGCCCGT
TGTGGGGTCGATAGCATCCGACGGCTACAGAGAGCCCAACCCAGGTTTCACCTTCCTCCTCTTGGAGATCTTCTGGCGAGTTTCCGTTTCACCGTTTCAGGTCCCATGGCGGCGGCGGCG
GCGCAGCTGCATGGATCGGCCGCGGCCGCGGCGACCTACCGACGGACTCGAGCCTACTCAGTTCCATCCTCATGCCGGTGGCTACGGACCCCTCTAGCCGCTTCCCCGAAGGTATGAATC
CGATCCGAGTGACCCTAATTTGGTGTTCGTGAAGCCTTTGCCCCTGTGTGTAACTTTGCGAAGAACCTGGTGTAGGGGTTAGCTGAGTCATGACAATATGAAATCCGATCGGGCCACGAT
TCGCTGGACATCCGGGCAGCTCACAGATATTTTTCTATTTGCTGAAACAATAGGGATAATTTTTTTACATGTGAGTTGAAGGCAGAACTGGTGCGTTTGTGTTCTACCGGTGTCACGTGT
CAGCAAATATCCAATTCCACCGAATCGGGCTCTTGTCCTTGAGGAGTCAAGGATTTTGTCTGCAATTCTGTGTTTGTTAGAAATTAGAAGGACTGTCTTTGGAACGTTCTGTTCTTAAGC
GGATAAAATTTATCCAGGATCTTGATCTGAGAAACAAGAATGTTTTTTATTTCTTTTTATCTATGCCATCACTTGAAGTCTTGAACAATGAGATGAACGTACTGTGTACACAGAATCAAG
TGCATTTTGTGTGTGTGTTGATATTTGTATTTTTTAATCAAACTATTACAACAAGACCTTTTTTTTAGCAACTATTACAACAAGACATTAATGTTACAGCTCTGTATGGATCTGTGGTCT
TTGCTATAGCTATTGGAGGGGTTAACATGTTTTGTTGTCCCAGCAGCTTTCGATTTCTTCCACTGAAGTTGGTATGAAGCCATTAGGTTTTGCTGCTAAACTTTCAACAAACGAGAACGC
TCGAGTTGAAGAGTTAAACTTGCAATCAGATCAGATGAAGGAATTTGTACAGGCAGAGGGGCATGTTATTCCCCAAAAGAGGAGTGCTAAAATTCATGATTTTTGCCTTGGGATTCCTTT
TGGTAAGTTCGAATTTCATGAATGTTTTGTTATGTGATTAGATGGATATAAATCACGCACAAGAGTACTTCTATCTTGTTAAATTTCGTTTTTAACCTTGTATGTGCAGATATTTTGCAG
CTCCTAATTTCAAGGAATTATGAACTTTTCATAGCATAAATTGTTCACAGCAGTTAATCCTAATGCAATTTTCAGAAATTGTTTTATGGCCTCTGGTAGCAAACTCTTCTGATCTCATAT
AACATGTTATGTCATAGAATCTTAAATAGTAGAAAGCAACATCATTATTTCTTGTTTCCTTTGCTTCCATACTCAAACTTGATTGACAAATTATTCTGCTGCTATGTTCAATATTCTTAC
ACGAAGAGTATGTCATATTCCTGAGTGCTTCAATATTATAAGTTTTTGGAATATGAACTTTGTTGTCTTGCATGTAGCCTTTTCACAAATTAATGAAATAACTATATTCCATTTGGTAAC
GCAGGTGGTCTTTTATTTTCTATGGGTCTTCTAGGATACATCTTTTCCAGAAGCACCATAAGTCTTGTCTTGGGCGTTGCGCCAGGGTTCGCCACTCTGCTACTTGGTACTCTCAGTCTA
AAGTTTTGGAGGAGCGGCAGATCCAGTTTCCTGTTTATCTTGGCCCAAGCAGGTAGGATATCATCATTCTAGCTTTGTCTTACCGTGGATTTGAGTTGCAATCACATTCAACCTTAGTAT
AAACATTGCTTACCAACCTGTTCCACTTCTGTTTTTGCAGCAATATCTGCTTCCCTGGCATGGAAATACTCTCACGCTTACTTCTTGGTAACTTTTCCCGCTCACATTCATATGGAATAT
GGTGCAATATTACTGTCTCAAAATTGCATTAATTGTATACTTCTTTGTGCAGACAAACAGACTCCTTCCTTGGGGTTTCTATGCTTCACTGAGGTAATTTATTCTGTATCCATCTTGGTG
CAAGACTTTTTTGTCCATTTGGAACAAGATCTGATGTCCCCTCCCACTTGAAAATTATGCAGCACTGCAATGACTTGTTTCTACGGGTATGTGCTGCTTGCCGGAGGGAATCCCCCACCA
AAGAAGCTGGCTGCCATCCCACAGCAGTAAAAAGAGAGATTCAGTCTAGGATCAGCGTGGTTGGCAGCATGTAGCACAATTTTGATTATCAAATTTGTATATTCCCCAACCTGTGGTTCA
CTGCTGGCTGGGTTTCTTTTGGCTCTGGTAGTCTGAAACTTTGAGCTAATAATGCTTCAGAGGATGATAGCCCTGCCTCCAGTGAACTTGCTCTGTTTTCTTCTACATGATGAATGTACG
TGATAAAGATAAGCTTGCTGAGCTTGTACTTGAGACATTTGTTTTCGAATTCGAAAGTTGGAGATGTTTTGTAGTCAGGAATCAGGATGGCTTGTAGCTTCAATTCTCAAACGAATGAAC
AGAGTTTCGAATATTCTGATACTTGGCATCTAGTTAAGATGACTATGGTTATCCTCTCAAAAACAAAGATGACTATGGTTATGCAGTCGTTTTATGGTTCCTCTAAAAAAAATCCAAAAT
CAAAGTACTTTCGGTTTTGAAAAAAAATTAATATCATATTTACCTTATTACCCAAGAGCAAGTAATAATAAACTAGTGAAGGCATGATGCCGTATTTGAATGGGCTTGCAATTGCAAGAG
AAAAGGTAGGCAATCCCCAAGCCCAACCAGATGGCCCAGCAAAGGCCCAACGAAGCCGGTCAGAACCGCCTCCCAGTCCCACCCGTCGGCCAGATCAGCCTTCAAACTAGGGTTTACTCG
TCCCGAAGCCAACAGCAAAGGCTTCCTCCACGCTTGAGCTCCGCCGCCTCCTCCTCCCTCCGCCGACTCCCTCCGCCAGGACCGCGAAGATGAAGCTCGTCAGGTAAGCCTCCCGTTCTC
GTTCGCCTCTTGTTCCGATTGACTCCTCTTTGCCCTTGCTTCGCCGCTCCGTTTGGTACGAACCTCGCCTAATTTGGTGCTCGATTTGGGGTTTCGCCGCAGGTTCTTGATGAAGCTGAA
CAACGAGACGGTCACCATCGAGCTCAAGAACGGCACGGTGGTCCACGGCACCATCACCGGTACGCTCCGACCCACTCCTCCGGCGGGGAAGGGTTTGGATTTCTGTGATCTAAAACTGCT
TCGAATTTTAGGGTTTGTGTCTGGTGCTTGCATTCTTAGGATTTGTGTAGCTCGGCCTAGGAGATGGTGTGATTTGCTTGTGCGCTACGGTGCTGTTTGTAGTTTTGGAGACTGTAAGAT
TGAGCATGCCTTTTGCACTAAGCTGTTGTGATTTTGATGAGGCTAGAAATTATTTCAGATAAAGCCATACTTTGGGATTACGCTATGCCACAGAAATATGCTATTTAGGTATGTTCAATT
AGACTTGGCCATTTTAGTCTTTTATCCTGCTTGGTTCGTAGGTGGTTTGCCCAACCCCGTATCGGTTGTAGGTTGTTTGCATTTGGTAAACCTTTTGTTTCTTCGATCAAGGGAGCATTC
TTGCTGAGTATTGACTGCATATGTAGAGATTGCAGAATGAACTAATCACAGGTATTTAGTTTTAGATCCATCAGTGCTAGGGAATGACCGGATGTCCTTTTTAAAGTAATGAGCATTTCA
TCAGTTGTCGGTAGTTCAAGTATGCAGTTGAATGTGCAATGGTTTTAGCTTCTCATGGACTGCTTTTGTCGTTTCCTAGACGGATTTGCTACTTATGAGACTTAGTTGATATCATACGCT
ATTGCACATATAGAAAGGTGTAAATAATGTAAAAATATTTTTATGAAATTCAGATGCTAATGTGTATTGTTTTTTCTTCCTAAGAAGGGTTTCCTGGACAATTACAAAATTTTAGATTTT
CTCATGTTACATAGGGTGTTTTGGGTGGATCAGGTTGTTCCTAAATTACGTTTTGATGTTTGGGGGGGGGGGGGGGGGGGCATGCAGGACTTTATTGTTCACAAGTAGGGGGAATATGCA
TCATGAAAGGCTTATTTTGAACTTTCCTTCCATTCTTGCTACAATTCAGGAAATAAGCCGCACATATTTTGCTAATACTGATGGGATTAATTTGGGACCATGGTTAAGTTTGTACAGCAT
ATCATCTAATTCATGCACATTTTTTAGGTGTTGACATAAGTATGAATACTCATCTGAAGACAGTGAAGCTTACACTGAAAGGGAAGAATCCTGTAACCCTTGACCACCTCAGTGTGCGAG
GAAACAACATTCGCTATTACATTCTTCCTGACAGCTTAAACCTGGAAACGTTGCTGGTGGAAGAAACCCCTAGAGTCAAGCCTAAGAAGCCAACTACAGGTTTGATTTCTTCTGCTCTAT
CTTCATTTTGAATCGAACCATTACTGATGCTATGATCTGACTGGAAAATATTCGATTGAAATCAGGGAAGCCTTTGGGACGTGGTCGCGGCCGTGGTCGTGGGCGTGGTCGGGGCCGGGG
GCCGCGCTGAGCTCTATAGTTCCCTTGCTGTCGGCTCTCTTGCATGACAAATTTCCCTACAATGTAACCTCTTTCCCCTGCACGCTATGTGAAAGAATGTTGCATTGTTACCCTTCTGAT
GAACTTGGACCTAATATCTCAAATCTCAGTAGTTCTTGTTGTGGAATCGCCCTGTCTATTTGATCCATGGTTCATGTCTATCTTAGGTCTACATTGTAGTTAATTGGTAATGTGCTTCAC
CTGGCATACATATAAGATGCCGCAGACCATTGGATACCTAGGTTGTATGCTTGTGTTTTCGCTACATCGGAATTATTGCTCTGGAGTTATGCTTTGCAGTCGCCTGCCTCTACTTGATCT
TTAGCTCTGCATAAAACTAAATTCCGGTTGGGCTGCTGGTTCAGTACTGAGGTTGCACATGGCATATACTGATTCATCTGAATCACCCTCCATCTACAATTTCCTCTTATGTGCGACATG
CTGTTGGCCTGTATTATTTTTGTTCTGATGTACAGACGAAATGCGAGCTAGAGTAGAGAATGCGTGGATCGTCTGAAGCTGCTGAAGCTTGCATTTCCTTGGTCGTTAACAGTTGGTTCT
GTTCCAGGATGTTCTAATGAAAGTCAAATGTTAACTTCGTAATGGTTACCATCGCTCACTGTCAGTCAGTCCAGGTAGAAATGATGAAATGATTACTAGTCTATAATAATGAGGTGAATA
TTTTAGTAGTAGTGTTTATCTTTGAGGTTGAGGCGTGTATATTTTCCCCCCACGCTATCAAAGCAGTAGTGTTACATTGAGGTGATTGGACATAGAGCTACCTCTTGCGGCCCGCCTGTA
TCGTCGAGGTCTGTTTGATGCGTTCTCGGCGATGCCCGGGCATCCAGACTGTTGATTACTGAGAGGTCGGGTCGCCACCAATGTGCCGTTGCCCTCGAACACCGGCTGTCGGGCTGTGGC
CAGCAATCGCCAGGCACGAGACGAGCGGCGAAGGCGCAAGCCCGTGCGATGGTTTCCCTTGCTGTTGGTACCAGCCGGAGGGTCGTAGCGCAAGCCACGCATCGCTCCCACGTGCCGCTC
GCGACCGCGACCGCGACCGCGCCATGTCGTGTCGCTCCGTTGCAGGCCAGCCGCGGGGCAAGCCACACGACCTGCGCTGTGCAAGCCGATGAACGCCGACGCGCCGACGTGTCCGAGGGC
GTCCCGTTCAGTCCAGTCAAGTCACGCTAAAGGATGAGTCGCGTTGATGCACAGGACCTACGACGAATTCCGACAGCACGGGTGGCGATCATTCTGTTAATTGCCCTCCTGACCTCCTCC
ATCACAGCAAAGCACGCGTCGCGATCGTATGTTCACTGCTGCTCGGGACCTCGTCCTCCGTCCATCCATTCCTACAGTTGTACAGGGCTACCGGATCACAATGCCATTCCCAGCAGGGCT
CCATCATCGATCCGGTCCCAGTGGCCAGAGGAAACACCACCACCGACCGCCTGATAGCGGAGCCACCCGTTGCTCTCTCCGAATTATTTTCTCCCACATGCCCCCGGGTTCACGCTCGTC
TATCCTTTTATCAATTCCTGCCCGCCGCTCTATACCATAGGTTCATTATAGTATACGGCAATCATTCCAACAGTTGGAGAGGGATAAAGAGAGGGAGAGGCCATGTGTCGTGGATTAGTC
CATACAGCCCGCCGCGATTCGATTCTTATCACACGGCACAAAGGCGCGCGGAAAAGGCACAGCAGCATCTCTCGCTCTCTCTTAGCCCGCACAGCCCCCTGGCTGTAGCTTCACTAGCAA
GCGATACCGCCGCCATACCGCCGAAGGGACAGGGCGACGCAACACTTGCGGCCTCACTGGCTAGCAGCAGCCTTCATCTCTTCCTCCGATAAGAACCTGCAAATCGTCTGGCCCGGGCAG
AGAGAGGTAGAGAATCTGAGAGAGGGGGAGAGGTGATCAGGCAGCAGCAGCAGGGGAAGACGCAGGCAGCAGCAGGGGAGACTGCACCATGTGCAAGCTCAAGTTCACCAAGGAGCGGGT
GGGCTGCTACATGCTGGTGATCCTGGTGATCGTGCTCCTCATCGGCGTCCTCTTCGGCCTCGGCGTCTTCCGCCACGGATACGACCACATCAAGGACATCGGCCGCAACCACACCTGCTT
CGACTGCAACAGGTACTGACGAGACCCACTGGGTTTGATCTTGCTCCGCGCTGGCCCCGTCGTAGCGTGCGTGCGTCAAACGGGCTCTCGTCGGAGCTGCCGGTGCGGGGCACCAGATGC
TGTAAAATAGTTTAATTGCTATCTTTTCTTTTTTTGAAAAGAAATAGTTTTTATCATCGGTGTGTAGTAATTTTCTGATGCCTATGTGCAGTGTGTAGGCAACAAGTTCGTGGTGCTCTT
TTTTTTTATTAGGGACAGTTACTATTATTCTGGCCCCCTCTTCTTGCAGTCAAGTTCATGGTGCTTTTGGCTCGAAACCTTCAATTTTGTTGGGTTTATACCTTGGCAAGAGCTAAATGA
ACTGTCGCGGTACTCCCTGTTTTCCTCCTCTGCTTCCCCTAAAAGAAAATTTTCAAGGAAATATTCAAGAGCTACGTCTGATGAGATTGTTTTCTTAAAAGAAAAGGCACCTAAAAAATT
GCGTCTGATGAAATCGGTATATAAAAAGACAACAATAGTCCGGTATATAAAAAGAAACGACAACTTGACACAAAACGATATCTGAAAAATAAAATTACACCGAAGATCTAAATACACGTT
TGACGAGAATTTTACTGTTACGATCAGAAAGACTTCGGCATGGAACGTTACCATAAGAATTATTTACAGCCGGTACTAGAATTTATAAATGATTGCCAAAAGCTATCACAATCCCAAGGA
ACGTTCAGGCCCTCTCCTTACGGAAGCAGTGCTAGTCAATATTCAGTCGGACGACAACTTTACAAGCCAAAGGATCAGAGGACGGAGACGTTTGGAGACGATAAATTAACAGCATCAGAC
CAAACCAAACAACATTTTATATTATTTTATTTACACATCAAACGGAAAGAATTCGTGGATGCTAAAAGACTGGACACAGATAGTGGTGGAGCCTGGCAAATTACAGAGAATGAACAGATT
ATGAACACCTGACATAATTTAACTGAATCTTTCAAGTCGTTCAGGGAACAGATTCCATTGGTGCGTGAAATAACAAAGCACCCTGGAGCAAACTATTTTCCACTCAGAACCACGAAGATA
ATGCGACTGGAATGTGCCACATGACAGAAGCCTTTGTACATAATCGCATTAGCTGATTAGCTGCAGCAGCCACCACCTTGAGAAGACGATGAACCAGCACCTCCAGATTGGCCAGGGACT
GCGTATCCAACTTTGATCCCATACGACTGCACGTTTGACAAAAGACAGTATGAGCTCATGCTCATGGGGTAGTAACAAGTAAGGATCTAACAAAGCAGAAGTGTTTCGGAGAGCAGGACA
AGGTTCCCAGGTGGGCAGATGGCATTTTAACTGTCAGAGAATAACTACTTTCCAGCCAAATACCTTTTCTACTAATCCTTGGACACTAACAAGTAATATTCTCACTTTCTCTAGCTCTTT
CTGTATCAAGACAAACACCTCGGACACTAACAAGTAATATTCTTTCTCCCTACCTCTTTCAGCATCAAGATAAACACCACCTCCACAAAATTACATTAAAAAATTATCCAATTTATCATT
TCAGAGAAAGTTAGTGCTCTGCGATCAATTATAGAAACTATGGGTACAAGGTCTTTGGATTCCAGTTTCTTTATTTCCTTTTTTTTAGAAATAAGATTCCAGTTTCCATATTTGGCAGTT
CAATCTTTCAGTATATGATGATTTCAGAAAAAAGGGATGAGCTTTCTACAAGGTGGGAAGCAGAGACTTAGGCTTCGATGCATATCATAAGGTAGTCCATATATAGTAAAATGGAACAGA
AAGGTGGTATTGGCTTTATCTCAGGGAAGTTTTTTGAGCCTCAATAGTTGGTTAAGAATGTACTGACGTTCCATAAATGATGCTTAAAGTACTATCGAAGGGGCTGGCAATGTTTTCCCT
AAGCAGAGCAGAAGTAATGACTTGAAATTCAAAAGGCTACCTCATTAGATACATCGAAAACACCATCTTGGATTTTCTTGTAGATTGCTCCAGCAGTCTTAACAAATGCCTGCATTTTAA
ATGTCCATATGAGAAATTTGGAATATTCTTAACCGCTCATAGACACACCAAGAACCAAGCATCACCTCCTCAACGTTTTGTGCGGTTTTCGCAGATGCCTCCATGAAGATCAGGCCATGT
TCTTTTGCAAACTGCTCGCCTTCCTCGTAGCTCACTGCACGCCTGTGAGACAGATCACATTTGTTCCCAACCAGCATTATCGTCATGTTGGCGTTGGCGTGCTGCCTCGCATCCTCCAGC
CAGCTGATGAGGTGATTGAAAGTCTCCCTCCTGATATCAGTTCCACATGGATTTGAATGCCAGGGACAGCACAATTCAGGAAACCATGCACATAAAAAGACTACGCAGGCAAACTTTGAC
TTATGAAGGGTAATTACCTGGTGATATCATAGACCAAAAGAGCACCAGCGGCCCCTCTGTAGTACGATCTAGTTATAGATCTGAATGACTCTTGGCCTGCCTGTAATGTTAAAAGGTAAT
CACATCAGATCAGATGAATGATCCATGTGGCCACGTGGGTGTTCCATTTCTTTTATATACTAATGGGTATTCCATATTAACAGTAGCTTAAAAAATTTAAATGGCCCAATGTGACAGTGC
TAGCTAACACGAATTTCACTGGGGATGGTGCAAACTGACAAAGGATATCCATTGTATCATAATTTCAGAGCTCAGCAAACTCCAAGGTTTTCATCTTGAACTTCAACACCCATGCCCTGC
CTCCGTTTTTTTTTTAAAAAAAAACATTATGCCACGGCAATTGGACATAATAAATTTTAGTTTGCAAGCAGACTCGAGTAGCTCGAGTCTCATGAGTAATCAAGCAAGCAAGTACTTATG
TCGCCCTAACTAGTAGTATAATAGATCCTATATCAGCACCAAAACGATCTCTAGCGTACAGTACAAACAAGGGATTTGCGTAGGAACGAAGGGAAGTATCAGCCAGCGGAGGAGGGCGAG
GAGAGGCAAACCGCACCGTGTCCCAAATCTGGAGCTTGATGGGCTTGTTGTCGATGGTGATCATCCGGGCCCCGAACTCGACGCCGATGGTGAGGTCGTGGACGGGCTGGAAGCGCTTGT
CGGTGAACTGCAGCAGCAGGCACGACTTGCCGACGCCTGCACATCACATCACCGGCAGCAACCAAGCAAAGGGAAACCCGTCAGTAGCGTTACACGCAGGCAACCGCACGGGCCGAGCAC
CCAAAGGGCCGCGCGGATCCAGCCGCGGAACGGAGAGAGGGGATCGGCGGGCGGGCGGGGTGCTCACTGACCTGTGTCGCCGATGATGATGTACTTGAAGAGGTAGGCGTACGACATCTC
CGGCGGGCTGGCTGGGCTTCCTCCGGGGAACGAAGAGCGGCGGCGGCGGCGGGAGGTAGGGGGGGAATTCGCGAGGCGCGCGTGCTAGGAAAAGTGGGGGTTGCTTAGCAAGGGGGCAGG
AGGTAGAGGAAACGGGGCGGCGGAGGAGACGTGGTTACGTGACNNNNNNNNNNNNNNNNNNNNNNNNNCGACAGCTAATTCGGGGGCGGTTCCTTCCTTGGGTGGAGGCGGACGGCGTGC
GGATGTTGTTTTGTTGGATTGTTATCTCGGCCGACCACGCCAACGGGGACCCCGCGGGTGGGGGCTTGGGGGAAAAACTGCAGTGCCGTCTGGTGCCAACCCGAGCCGAGCAGACTCGAG
TCCGGGAGCCCAGAGGCATCCGAAGAAAGGAGCACGGATGACGGATGGGGTCGCCGGGTCGTGGTCTCGCGGACGGACGTGGCTTGAGCTGGACTGCTGGAGTTGGGAGCCTGGAAGTGG
AAGGATGCTGCTGCCAGATCGGCGGGTTCCAGGTCAAGACGGTTCCGGAAGGGGGAGAGTGCCCGTCGCAATCAGCTCTGGACCGAGTTTTTTTTAGCTCTCTCTGTTGAGCAAGCCAAA
ACACACCCTCTGGCTAATGAATTTTTCTAACACTAGAGAAATTAGCATTTGTCCTGCCGATAATCCTCCATTCATTTCAGCTTGGCGTACCTTTTTCTGTCTCATTTTTCCGCATCCGCC
GTTAGCTAAACATAGACTTAGCTTCCGCTATCTTCTTTTTACCATTTAATAAAAGAACAAACGTGGTCACTACATCCCTCGTCACTTGTGCACCGGTTTGTGTCTCTGCTTGGGCAACTG
TGTTTTCTTCGACATACTACATTACTACTTGGTAGCTAACTGGGCTGGCACTGGCAGTGGCCGAGCAAAACATTTAGACTAACAGAATGGACAGAAATGTTACGTCCGCTTTCCACTTTC
TCGGCCTGTTGGGCTTTCCACTTAGACAGCGGGAAGAGGCCTCTTGCGACACCACTACTACCCACAGGCCGGCCCCTCTCCTCGTAGCAGCGCACCACGGCCCACGCCTGCCCGCTTGTG
CACAAGTAAGTGGCGCCAGCAGCGAGGCGGCGGCGGCGAAACACACACAACACAACCAGGCCCCGCGCGCGTTTCGCCTCCGTCCACACGCCGGCGCTGCCCCGGCCTTTTGCCTTTGGT
CCATGATGGCAACGATCCCGGATGAACAAACCATCACATCAGACGGAGTTGGCGGGTTTTTTTTTTTGAAAGTACAAGTGTTGGCGAAATTAGCGAGCGAAAATTCTGCAGAAAATACCG
CCCGGGTGGCCCGGTCAGTGGACGCCCATGCACGTGGGCCTCCCATCCGACAGCGATCTCACGTATGTACGTCCAGTACGTACATACCGAGATACACGACGAGACGAGCGCGCAACTACT
GCTACAGTGCTTGTACCACTGCTACCTGGCAGGCTAGCACACGTGAACGTGTTGCGGCAGCTACTGTACATCGTACCTGTTCACCAGAGGAGGAGGAGGGATATCGATCGCGCATGCATC
AATCAAATCGCGCCGCGCCATGCGGCACAGTGACGACGGGCCGGGTCACGTTCACCGGTTCGATAACGTCCCGTACGCGTACGCGCGCCGCTCGCAACAGTAGACGGAAAGGCAATAACC
GCGCGCGTGCGCGCATATGCATGCACGGGACGCGTCGCCCTGCCGGCCCGGCCGGCCGGTCGGCGCCTGCCTCTAGCTAGCTGCGAGCTGCGGCTGTAGTGCTATACTGCTACTGCACCG
GAGGAGGAGTAAAGCCGTGGCCGTCGGCGACGCGCGGTGCGTGCGCGGCTCGAGGATGGTTGGTTGGTGGGTGGGTGCGTGCGGCGCGGCACGGCGGGATGAGTGGCCGGTGGGTTCGAC
CACCGAGCAAAGCGTGCGCGCGCGCTGCGCGGCCAGCCTCTCCAACAAGGCAACAAAGCACGCAGCGGTGGTGCATGGTAGCTAGCTCGGTCAAAAAGCTGGCTAGCTATGTGCTCAACC
GCCACGGAAAGCCAAAGCGCGATCCACCGAGACAAACCTGATGTGATCGAGTAGCTTAGCCATCATCATTACGAAGCAAATCCCAGCCGATCGGTCGTCGGCAAAGCGCTAGTACTATTA
AATCTCAATCAAAGGTTTGCAGCTTTGGGGATTAGTCAATGCTCGCACACGACCGAAAGTGCACGGGCTGCCGATCGAGCTAGAGATCATGGCGTTTTGCGGCGCCGTCGCCTGTCTACA
TGGTCACTCGCCGGCCTCTCGATCGGCCTGGGGTTTTGCCGCGAGAGACCGGCCGGCGTTGATTCAGTGTACGTGCGCCCCCGCGTGCCCGGCTTTCTTTTGGGTTCGTACGGGGCCGAT
TCGGCCGAACGACTGGGTCGAATCGGATGCCACTACTGCTCCATGCATGTGTGTGGCTTTACTTTGGTATCGGGAGTACTCCATGAATGCGTAGTAGTGTGTCGTAGAGTTTGACCTGAC
GGCGGCGGCGGCAAAAGGTTTGAGTTGAGCCGAATGCTGAAACGCGTGTCGCCATGTAGCAACAAAGTTAACATGACTATCATTGCATTGGACGCGTCGTAGCAGCGCGGTCAGTGGTAC
CTGAACGAGGAAGTTAAAAAGGAAATCACATGAGTGCATTTGCGAAAGGCCCAGGCGCATGGTTGCGTGGAGCAAGATCAAGTTGACCGAGTGACCGTGATGCATCATCTTTCTCTGCCT
CTGCATGCCGGAGAGTCCTTGCCGACTGCGATGCACGAGTTCCACGTGTCACGCTGTGCTTGGTAAATGATCCCTAAAAAATGTGCATAATATACGGCCATGAGTTTGTTGTGTCGTGCA
AAAAAAAACACAAGAAAAACTAATGAGTGTACTAGAACTTTCTAGCACGGCCCAGATCTATATTCTACGCATATAATTGCCAATCACAGCGAGCCTCTATATATTAAGCTTAGACTAGCT
TACATCTAACAATGATTAAAGGAGCGCGCAACACCAGCTAAAATTAGCTTAAACTACTAGCCTCTTTTGGGCATAACTTAAACATCTCAATTATGAGCAGATTACAACCAAGATCCAGAG
GAATATGTTTCCCACATGCATTCCAAAAACAAACGCCGCGATGACAGAACATATAGCAACGTAAACAAAACCCCACACACCACATCATCAACGACCGCTGAATTGTTAAGCAGGAAACCG
ATCGAATGAAAAGCAGCCACGTCGCCTCCGTTGCCTCGATTAAGCATTTGTAGCTTTAGCCAGATGAGGCAAGGGCCACCACCTCGCACGTGCACTAAGGATTACTAGATCACCGAGCAA
ATAAGGCTGCTTGATTCCTTTAGTCCATGCACTAAATTTTAGTCCCTACCCTGTTTGGATCCATGGATTAAAATCCATTAATGCAGATGAACAAAGATGATAATACACCTAATCAATGTG
CAAAACTCCTGCTCCATGCGGTTTCATAATTTTCCTCTTGCTCCATCAATCTCCTCTCTCACTTCTTATCTTCCTCCTGCTCCATGCGGTTGGATCCGGCGAGCTACAGGGAAAAAAGAA
ACGAATGTGATGGTGCTTGTGCTTGATTGGGTGGAGATGGACTGCGTGGCGGGATGCACCACCTCCGATCCGCCGGGTCTCTCGCCACCGCCCATGGGTAGTGGAGATGCGGCGCACGAC
GCACGTGGGCCAAGGACGGAGGCCGCATCGTGCCTCCACGCCAGGCGTTGCCCACCCTGGTTGTGCGTCGCTCCGATCGAAGCATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGAGCGAACCCACACGGCC
AGGCGGACTGGCGGGGCCGTGTGGGGAGCGGCGCGGTGGGCGGACCCATGCACTCAGGGGGATCGGCGATGAGCGGCAGGCAGAGATACAGGAGGCGTGGAACGGGAACGAGCAGGGGAT
TTCCTGGTGGTGGGAAGGACAATAAATGAGGGGCAGGGGTGTCTTCCAAAGCTTTTAGTCCACCCCCCTTGGACTAGAGGATTAAAGGGTTTAGTCCACATGTTTGGCACTTGAGGGACT
AAAAGGGGCCAAAATGGATGGACTAGTTTAGTTCAGGGTAACCAAACAGGGCCTAAGATACATGATCCGTGGACTGAATTAGGGCCTGTTACCCTGGANNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTTAGTCCTCTTGTCCATATGGGGTGGACTAAAGTGGACTAAAGGGTCTTGGGGCACCCCTACCCCTCATTACTC
CCCGTCCCANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTCCTCCCCACCACCGCACCCACCATGGACCGCTACCGGGACTTCTTCTCTCAGGCGGC
TTCTTCATCCGCGGCTACCCGCAGCTTCCGTTCTTCCCCGGACGCCCGCAATGAAGATGACTTCGGCCCCTTCTCCTCACCGACGGCCCCCACCCTCTCCACTCCTCGGATGCNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGCTGGAGGCGACCATGGGCTACCTCCTTTTGCCCTTGGAGGCAG
AGTGGGAGGTCGTGGAGGTCGCCGCTTGAGGTCCATGAACACTAGAGCTGGATTCGGCGGACGTAGAGTGGGAGGCCGTGGGGGAGCCGTGTCTACTCGCGGAGGCAGAGGGGGAAGTCG
TGGGGGATTGATGGTACACCGCGGAGGCCATGGATCCTCTGTTGCCGGCCACACCTTCATTCCTCGAGCAACTTGGCACCTTCAAGGCGAAGATCCATGCTCCTATTCCTGTGATGTCAA
TTTGTGCCTCTGAATGCATGTGAATGCCTCTGAATGCATGTGAATGCTTGAGATGCCCTGCTAGCTGAATGACTGTGAATTTGTGAAATCAATTTGCAGTAGCTCAAGCCCTGGTAGCTG
AATGCCTTTGGTTTTGTGAAATCCATTTTTAGTAGCTTATGCCCTGGTAGCTTAATGCCTTTGGTTTTGTGAAATTCATTTTCAGTACATGCCTTGGTATCTGAATGTCTTTGGTTTTAT
GAAATCCATTTGCACTAGCTCATGCCCTGGTAGCTGAATGTCTTTGGTTTTGTGAAATCCATTTTCAGTAGCTCATACCCTGGTAGCTGAATGTCTTTGGTTTTGTGAAGTCCATTTTCA
GTAGCTAACTCACAAATCAGTAGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTGTGATGGTTTCAAATGTATGGACAGTTTTTCAAATGTATGAAT
AGTTTTATGAATGTATCACAAATTTTGATTATGTGCCGTGCGCCCAGAAGCCAGCAGCGCGGCTAACTTGGCACCAGAACAGGGTACCAGGCACCTAGAACAGGGTACCATCAACGCCCA
GAACTTGGCACCAGAAACAGGGTGGCGCTAGAAACAGGGGTACCAGTCTGGTGGGAAGCAGGGGTAAAAGAGTCTTTATTCAACTGCATTAATGGACTTTAGTGTATGGAACCAAACAGA
TTAGGGACTTAAGTTTAGTCCATGGACTAAAGAACAGCACCCACTTAGCTAGCGTATCAAACAGCTAGCAGATCGAAGCAAAGATGACCATGCATGGCTTGCATGCATGCAAATGATTGG
ATTACTTGTAGTTGCAGCAGCAAGATACTAACGGTAGTTTGATGGTGGTTGTTGCTAGCCGATGATGGGTGATGCGGCTCCCTTTGTGAAATTGCATTTGCGTGTCTTTTGGGAGGTTTG
AGAGGACAGTGTAGTTGCACGTACTGCAATATTCCATTACCTAGCAGCAAGTGGCCATGGGATTATAAGAACATGGCATCTTTGATCCACCCAGCATATCCATACTTTGTTTTTGGTGGT
CCTGCACTCCTGCTTGACCTTCTTTTGCAGCCTGATCGATCGATCGACCAGGGAAAAGATCCCTTTGGGAAGACTAAAGGAGCTAAAGCTTCAGACTAACTCATAACTTCATAAGCGACG
TAGCAGGTAGCACACTAGAGAAAGCTTGGGAATGCAACTGATCGAGAGGCACCACGAGGCGTTGGTTTAAACAATCCCTGCTCGCCGTGTTCCAAATCTGATGTCCATATTATGGTTGGT
GATACATCCATGTCAAAAATCTGAATGTACTCTTTACGCGTCTGTGCAGCGGTGGCAGTCTTGTACTTTGTTTTTTTTTTTTTTGGTCCCAAGTCTTGTACTTAGCTAGCCAGGTAGCTA
ACGACATGGCCTGTGATGTGGGTTGTCAAGGACACAAAGTTTAACGCTAAGTAAACTACGTGCTGGTTGGACGAAGGCCAATAGTAACACAGTACGGTCGTCTGTCCCTTTTGTTACAAA
GGTATACGGACGTTGCGCACCGGTTGTACTTGCGCGTACGTGGGTTGAGTGGTTGACAATCATGTTCCCTGTACGTGTTGTTGGTAGAGAGACGAAGAAGACGGCCGGGAGAAAAAGACC
GAAACACCCCTTGTAAGACAACGCGGGCTCGTCCTCTGATGAGGGGGAAAACACTCATCAACTTGCATGGACGTACGCTAGCCACTACGTACCTCTATAGTAACGTGTGTACAGACCTAC
GTACGTGTGGTCCCTTACGGCTATACGATGGACACACATGTGGTAGTTCATTACAGCATGGAGACAAGGGCGTCTACAGCGCTGTACTCTAGCTTGTACTGTAGCCATGTGGGTACAAAG
TGATCTTGCCCTGCCCTCGTGCACACGCACGCACGCACGCTAGCTATGAGCCTATGACTAGGTGGCGTACGTGCACCTGCATGGTCCCTTTCATCGAGTAACGCAAGTGCGCGGCGACGT
GCCGGCAAATATACGTGCATGATTAGGTCCCTGATTGATCGAACATATCGCCAGAATAAGTACGAGTGCGCACGTACACGCCCCCCGTACGGCCTTCCGAATTGGGAACCAGTGAAGCTC
GCAAAACCAGTTTGTATACGTGTGTGTGTATATATCATTTTCTGGGATAACTCTGAGGCGACAACTAGATATGATACACTATCTCCATCCTCAAATATTAANNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNTAATATTTATAAGACAAACTAATTAGTTAAAGAACGAATGAACTAATTTATTTATTCTATAAATGCCATATATTTAAGTAGCTTGTACAATTTGCGTGGAGATTACAATCCT
ACCATATGCCACTTAGGGGGTGTTTAGATTAGGTAGGGATTATGAAATCAGATTAAAAAAGTTATTAGTTCTAAATTATTATTCATTTTGATTTTTCTAAATTTATGTATCTAGACATAT
ATACATGTGGGTCCATAGCAAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCAGAAATACAGCGGCTCATATCTTTGTAATCTCATTATCT
CCTTCGACCCAGCTATTTTAAGATCATAGACACGACTATAATCTATTTTAAGATTACATATGCAGAGTATAGAGATGGGACGTTCCGACGACGTTGGGTATGCTCACATCCGCGCACATG
TTTGCGTTACCGCGTAGCGGTGTGTAGCCCCTACACGTACTACACGTCTGCACCGCCCTCGTTCTCGTCGTCTAGTGCATTAACGATCGTATCGTATAGTACACTCCACTCCACGCACCC
GTGCGTGGCGCGTCCACACCACACGTGCATGCATGCACGTACGCGCACCGGCCGGCTACAGGGCGGCTATACGTACGTGCGCTAGCATTACGATCGATGGAGCTAGGCATGCACACTTAT
TACGACCACATGCAAGCATGCTGCACCGTGCAAGCATGCTGCAAGCATGGCTAGGGTCGGTGTAGTGTGTGGCCGTGTACGCTGCGCGTGTAGCGTGACGTGCGCGTCCCTATTACTACC
GCTGATCTACGTACCACCGATATAGGCGTACTATAACGAGATGGGCGTGGCGGGCATAACCTATAGAGAGTCCAATTCAATGAACTAAATGGAGTAGCTACTCCTTCCTTTCATCGCTCT
AAGAGTAGATTTAATTTTGACCGTTTTCTCTTGCGTTATTATATTAAAAAAGTTGCTACAGAATCAAAATCTTTTTTCGCGACCGTGTTTAGCATGTTTTTTTATTAAAAGAAAGTACAA
AATCAACATCTTAAAAGTAACTCAAATATGAATCTAAATGGTCCAAGTTTTGTACAATAACGGAGATTTTAACTAACTGTTACTCCACAGTCAAGATTTATAGAGTTTTGACTTCTTTGG
AATAAAAGGCATGTACTGGCATTGGTACAACACAGAGGGAGTATGCAGGAGAAAAGCTCGGGATGATAAGAGGATCTCAGCCTCAGTACTGAGAAGAGTGAGCTTGCTGAGTGTCGTGGG
ATAAACTTTCCACTTTTATTTCTCGTAATACTGTTGCTAAATTAGCAACAATATTGATGTGGTACGATCGGTAGAAGTACTAGTCGAGCGCAAACACACACAGCTATACCGTACCCCTCG
GAGTCTCGGAGGTCATCCAAGCCCACTGCAGAGTGCAGACAGCCGCATGGCAATCCGATCCTCATGCATCGATGTTTGCAAGGGAATTCAAGGCGCCGGACACGTCTCCACACTGGTTTG
GGGTTGACCATCGGCCATGTAGTACATCTCTAGTCTCTGCTAGCTGCCTCTCTCTCATTACGGACTGAATTTTTAATCAACATAGAGGACTCATCATACATCACATCATCGGAATAAACA
TATCGGACCGGAGCCATGCGCACACATGTGTATTGCAGGCCGCACGGGTGCGATGAATGATAGAGATATTGCGCTGTCGTCTTGCCACTGGCTGAACGATCGGTACAGGTGCCATGCGGC
GTTGCTCGCCGTCGCCAGCCGGACTGCCGGGGCAGAAGTGCAGAGCAAGCAGGCGAAGACGACTGAAGACTTGCTAAACAATGGTCCCGTACCCTATGCATGGCGTGGTACGCAGGAGTA
CCGTGCGCATGCAGTCATGCACTTGCTCTGCTCGCTCTCTGAAAGTGTATGGGAATTGGGAGCAGCTAGCTAGTTCGGTCTTGGGGTTCGGAGAGCTGGGAACCTGGGACTGCTGGGGTA
TGGGAGCGAGGACGCACGGGGGGCCACGGCGAGCGCTGACTGCTGACGCGGGGGAAATTGGCATTGGGCGGACCGATGCGGCGATGCCGAACGCGATGAGACGAAATGAATGCGCCCCTC
GTGCGGGTGCGTCCGCGCATGCAAAGCAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAACGCGATTACGCAATGCGCTGCGCGCACGGGCGGCCGGCCGCTGGTCAAAGGCCCGG
CCCCAGCGGCGGGCAGCGGCCAGCAGCCACCACACCCTGCCGCTCTGCGCGCTCGCTTCACAGCCAGCGGCCCAGCGCATGGGGTCATGGGAGTGTGTCGTCGTCGTCCTTGTCCTAGGC
GCGGCGCGAATCCCCGCGTGCCCGGCATGGCCACGCACACGCGCGCGGCCTCTGCCTGGCTCACTGGCCTGAGCTCTGTCTGGACTCTGGAGTGGTACGCCGCGCCGCGCGCGTGCACAC
GGCCCCGCGGTCTGCCTCAGCCGGACGACGGTGAAATCTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNGGGTTTCTCTTAGCGGGGGGGCGGGGAAAAATTTTTTAAAAGCCAAGAGGTAAGAAACCTTAAAATTNNNNNNNNNNNNNNNNNNNNNNGTGCCATCTCGA
GAGGCGCGCACTCACGGCCCCAGGCACGGCCTCCGAGGCCGAGACCGCGACCATGCAGGGGCAGGGGCAGCCGGCAGGTCCTGGTCCTCCGTGTGCCCCAGGCCCCAGCCCCGGTCATGA
CTGTCTGGAGGAGGTCGAGAGGGCAGGAAATGCGGTGCCCTGCCCCCGCACGTACGTGACGTCTGGCGTGGCGCGGCCGCTCGCTCACCTCACCTCGGTTTGATTTGATTATTGGCAGCA
GCGAGCCAGCGTCCAGCGAGCGCGGCGCGCGGCCTCGTGAATCACACGCTCTCTGCTGCAGAGGCCGTCCGATCCGGCGGTCGCTCCGGCCAGGGTGCGCCATGCCATCGCCACCTCACC
TAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTACTACAGCATTTAGTAGTACAACGTTTAGGCGCTGCCTGCATCTGAGTCTGAGGTATCGCAACACCAGGCG
ACGACTCGATGCTGGCGTCGTAGGTTCAAGGAACCCGCCCAAGCACAATCTTGCGTCTTTATCCAAAAAAAAACAAATCTTGCGGACTCGATGAGGCATCTGCAACGATCCAAGCACAGG
TCCGGCGGCATTCCATCAGCGACACTGTCGACCACGCTTAAGCAGAAATAATATTCTCCCGACCCCTCAACCACAGCACGAGCGCATGAGCCGGCAGAAGCTGCTGGGAAACAGAGGCAC
AGACCGATCCACCATCATCGTCGATCCATCACTGATGAGCAAGTCGGCAGAGACGATCGGTGAACGACGACAGCACGTCCATGTCCAGGCATCCTAATCACCTGCAATTAATCAGCACTA
GGCACGCATTAACAATCGCGGATAAAACAAGCGAGCTGCGTAATTAAGTACGAGCAGCGATCCAAATCTGGCCCTGGCTGTGGCTGGCCGCTCAAGGACGAGCAAGCAGGGGTGTGCTTC
GAATCCATAGGAAGATACGGGGCAGGCGCGAGCGGACAAAGCGGCGCACGAGGGGGCATCTCGACCTCTCGCTGTCGCTGGCGCCGGGCCAGAGGGAGAATGGGACGGATCGCGGCTGGT
TGTGCGGCCACAGTTCCCCGGTGCCCTGCTCTAGTGCTCTACCAGCTAGTCCTAGCCGCCCCCACATGCATGCTTGCAGCAGTCGAGGCCTTCGCTTCCGATCGACCGATTTGGCCTGGT
AGCAACCACACACGCAGACTCCTGCTTTGATCGTGTTCTTGCTGCCGAGCACGCGGGTGGTGAACAGGTTCATGGTTTTCTTAAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTAAGTACGCCCGCTTGGAGGATATACAGTACTTGTCTCGTTTGACCGTCA
ATGTCGCTACGCTAACCATGTTCTTCATGGATGTTAACAAGATTATTCTTCTTCCTGGACAAGACAACACCACCTTCGAGGGCTTCCGTAGCCTTGCACGTTCCAGCACCCTCCTCGTGC
TCCATCTCACTAGCGATGAGTGTAGGTACGTGTACGCGAGCGTAGTGATTTTAAAAAAAACATTAGCGTTTGGAAAAAAAAGTCATGTCACAATACCTACAGCAGCAAATTGTACTCCAC
TGAGTGGGGCCTGCCAAATGAGGGGCAAATTTTGTAGGAATACGAAGGGTTTATTAATACTATCTTTTAAGCTAGATCCGGAAGAAATCTAAAACCATAACCCTTACAAACTTTGTATGG
ACACCAGAGAGAGCGATGCANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTGAAACTCCCAAATAATTGACTCTAATTTGTTATAGACCTCTAAAG
GTTTCTTCCAAAAAAATAAGTTTTTTTTGCATTAATGAGTTGTATTTGGTACGGACTCTTGTCTGATCCAATTAAACTATTTGATAATTCTAGGCCATGAGAGCTAGCGACTGTGATGGT
TTGATTTGACGTCCCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGAGTAGCCGGAGGTAGCGAACATGGCTCCATCAGGCTAGTTTGTAATTTTGGTGATTGAGTAACAAGATAGTTATTGGGACTAATGGTT
TGTCAAGCATATAACTTGTAGGTTTTCTAGGTCTCAAATATAGAAACCAAACCATGGCAAGGTCCAAATCATGGTATTTAAGTATCCAAGCTATGGTATTCTTGATGTTCAAATCATGGT
ATTCAAGTATCCAAGCTATAGTATTTAGGTGACTAGCCATAGTATCTAGAATTATTCTATGATATTCAAGCATCCAAGTGATGGTATTTTTGGTGCTCAAGTGGCGGTATTCAACTTAGA
ACATCCAGTACCATCGGATGATCCGACGGTCCATCGGAGCAACCGTTGGAGCAAGCGTCGGAGCAATTAGTATAACGAGAAATAAGGGAAAAGGAGTCGAGACCATCGGGTGTTCCGATG
GTAGGATTTCTAGTAGAGTCGGATGAATTCTTGGGTGAAGAAATTGAAGACAAAAAACCCTATAGCACCGGATGATCCGATGGTAGGCTAAGGGAAGCGCGGACGAAGCATATTTATTTC
AAAAACTTCTAGATAGGTTTTGGGCAAAAACCCTTTAGCACCGGATGTTCTGACAGTGCCATCGGATGAAGCGTCGGATGAATATGGGATGATTCATTGAAGAACTTGGACGCGGGGAGG
CCAATGGCTAGTTGCACCGGATGTTCCGATGCATGCCAAAACAGACCATTGGAACATCAGATGGTATACTTTAGCTAGCCATTGGAGCAACGGCTCTTTGATGCCTTGAGCTATTTATAC
CCCCTCCACTCGCCCATTTGAAGTAGCTGGAGTGTGCAGAAGTCTATTGGAGATAAGGACCCATCAATAACACATCCAAGCCACCAAAAGTGCTTAAGTGATTATTCTAAGGCTTAGCAC
AAGCTTAGGAGAGTGATTAATGCTAGGATAGGTGTAGAGAAAGGGAAAGTGCAAGGTGTGCCTACCGTGTGATCGGTTCTAGGAGTGAACCACAGTTGTACAAGGTGTGCCGGCGCCTTG
GAGCCTTGGTGGCTCACCAGCAAGTCTTCAACCCTCCGGCTTGGTGTGGAGCGGCGTCGACGACCGTGTGCGGGGGACGTGGAGACCCCCTTCCTTCATGGAGAAGCTCCTTAGTGGAGA
CGTGGAGAAACTCCTTAGTGGAGATGGTATCAAGGTGACTGGGGAACTTGGCGTGAGCCTTAGTAGCCAAGCCTTTGTGGCAAGTCAAGGGGTGCCCCAGAAAAGACTTGTGACTGGGAA
GTAATACTCTTGTGTGAGTGCTTTAGTGGTGGCTTAGTGTCTACCGATACCACGGGATAAATCTTCATGTCAAGAGTTTGCTTCCCCTCATCTTACGTTTCCGCATTTTATACTTACAAC
TTATTAGCCTATACTTTCTTAGTGCAGTCTCTTGCTAGGATTGGGTCTAGGTTGCAAAACTTGTTTTGGATGAGGGTTCCACACTAGATCAACCATAGAATGCACGTCTTGGATAGAATG
ATCTAGTTTATGTTCATGCAAAATAGTGGAAACTAGATGCTAAGGTTTTAGTTTGCCTAATCACCTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTCCACCACCATTTCTCTCGTCGAGGAATATTTTTTGCTCCGCTCCACGCACGGCTGCCCGTGTCGCGGTGTCCTTTGGGTCGGGC
GCTCCAAGTACATCTGGGGTGCGCCCGTGCTGAGTGTACAGGCCTGGTGAAAATCACGGCAACTTTGCTCTCTGACTTGGCCTATTTTCTGATCGGAAAGTGCCCGGTTGCCCAGGTGCC
GTAGTCCAAATTTATGTTTGACTATGCGCGCGGTGCCCGTTTCCAAGCCCAGTGGTACTGTCTGTACATTGATCATTTGAGGAGTGGCAAGTATGTAAAATGATTGGCTTATGATGCTAT
ACTGCACAATGTCGTGGATCATTAGAAAAGCATTACGAAATTACCAAAGAGAGAGATAGTACTTTCTTCTAATAAAATCTTCACGGCAAAGTTCTTGCCGTCCTTTCGGGGAAAAAAAAG
AAGAGAGATAGTACTTAATATAAGAGGTTGAAGCTCATGTTCCAAAGGGGAAAGAAATCCTACTCATTAAAATCCTTTCCACAACATCCCTTGGAAATTCTTCCGATCCGAAGGATGTAT
GAATTAGTGAAGCCGAGGCTAGCCCTAATGCCGGTTCCATTCTCAATGAATTAGGTGCAACTCACATAAATCTAATGACAAATGCTTATAATTATAAGAGGAGAGTGGTTTCATACTTTC
ATCAGTATATGTTTTCACATCATGCATTAGGCGACGTGAGGTTTCATTATTTGATCATCAGACAACCTTCGATCCCGTATATCGGAACTAAATGATATGGCTAGTCTAGAAAAAATAAAC
GAAACTTTTCAATAAGATTACCCTTCCACACCTTGTATACATAAGAACTAAGTATAATAAAGTGGTACAAGCTGGCTGTAGATGTTGCCATATTAGGTTGGTGCTGAGTGAAGCAAAGAG
AAGAGATTCAGGNNNNNNNNNNNNNNNNNNNNNNNNNNNGTTACAAGAACTTGTTCTTGTAATGTAACACTGGCTAGCAACTAATTATATTATTAGGCATACTCTAATTATATATTTTTG
TGTGTGTTCGGTTGGGTTCATTTTGGTGACGGTTGTGGGAGTAGGGCTAATAATAATTGCCAGCACAGGGCAGGTTACTCGGGGTGGGGAGTCTTGCAACAGTGGTTGTCGGAGTCCCAT
ATGGTACCAAAAGACCTGACGACTCTCTGTTACCCCTTCTCTGTAAATGTAAGCCCAAGTAAAGTTACAAGAACATCGCGCACCATATATCCGAATAAATTGTTTAATTTGCTGTTAATT
CGGTACTATGGCGATAAGCAAGTATATGCAAAGTCAAACTATATATAATCAATTTTAAATGTGAGGATTTTTTCTCCTAGATAGGCACACATTGACCTAGGATGATGAGATTGTACTTGC
ACTAGGTGTAGTTTGACCATCATGTCGACAAACAGAGGCAATAAGATAATCGGAAGAAAATCTTGAGTACTCCATAGAACATAAATCATTGCCTCGCCAATCCAATCAATGTACTACCAC
TGCTAGAGGACACAGTATTGTCTGAAAGTGTGTTTGAACCTATTTTAGAAACAGTCTCTGATGCGTCCCTGGCGATGCGTTCAATTTGACTACGATCAAGGCAGCTCATTTGCTACGTTG
TCTGAACTATATATAGCTCCAAGGATTAGAAGCCACCGTTCGTATTTTGTTTTTATTTTTTTAAAAAAGAGGCTTACGTGGTCACAAGTTGAAATTTGCAAATCTCCACATTCGCCTGGC
TTGACCTTGTCCAGACTCCAGAGCACCGCAGCCCTGGCCGTTTGCACAANNNNNNNNNNNNNNNNNNNNNNNNACCTGCGTGTTTGACTGCACCTTTGCAGCCTAGATGCTAGGCTACCC
TACGCTGGACCATCCTCCTAGTCCTAGCTATAGCCCCTCCCTTGATAAAAGCTACACTTATGTTACTGTTCTGTACTGCATCACTGAGGTAATTTGGCTGCAGTAAAAACAGAGATCATA
CTGCCAGTACCTTTTGTTTTAGGGAAAAGAACAGAGATCATGCTACTTCAATGCATGGAAGAACACTAAATAAACAAACGAAAAGAAGGCGGCCAAAGAAAGGAAACAAAAGGCAGCCTT
ATTTTTTTTCCCTCCCCTCTCCCTTTGCCAAGATCCTTCCTGCCTCGCTTCTGCTACTATATAGCTCCCCCCTCGCCTCGCATTCCAGAGAGAGAAGGGAACAGCAGCCCAGGGGTGAGC
TGTGCCTGCGTGAGCGTTTGAGCAAGCTAGGCGAAGCATTCGTACTTACAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAGATAGACAGAGTGATTCTTGCTGGCTCCATGC
TTGTGAGATGAGACTTGCGAGTGGTGGTCGATGATGGCGGGGGAGCTCGCGCTGGCCGCTCTGGCGATCCTGCTCTCCTCGCTCCTAGCCCTGGTGCTGAGCCACTTCCTGCCCTTGCTC
CTGAACCCGAAGGCCCCCAGGGGCAGCTTCGGATGGCCGCTGATCGGTGAGACGCTCAGGTTCCTCACGCCCCATGCTTCCAACACGCTGGGTGGCTTCCTGGAGGATCACTGCGCCAGG
TAAATACTCCAGCGTTTCATTTCCTTTGCTTTTACCACCACCATCCGTGCACAGCAAACCACAGATCCTCTTAACTATATATTACCGCGACATCGCAATTAANNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTAAAAAGGTTAAACGATGATTAACATGGCCG
CGGTAACAGTAACACCAATGTTGTTGTTGTGGGTATGATGCTGCTGCAGGTATGGGCGGGTGTTCAAGTCCCACCTGTTCTGCACCCCCACGGTGGTGTCGTGCGACCAGGACCTCAACC
ACTTCATCCTGCAGAACGAGGAGCGGCTGTTCCAGTGCAGCTACCCCAGGCCGATCCATGGCATCCTGGGCAAGTCCTCCATGCTTGTGGTCCTGGGCGAGGACCATAAGCGCCTCAGGA
ACCTCGCCCTCGCCCTCGTCACCTCCACCAAGCTCAAGCCCAGCTACCTCGGCGACATCGAGAAGATCGCGCTGCACGTCGTCGGCTCATGGCGCCAGGCGGCCGGTGGCAAGGAGTGCG
GCGGTGGCGGCTGCGTCAAGGTCATCACCTTCTGCGAGGAGGCAAGAAAGGTTAGCAACTGTACTCTTGCTGTTAATCCCTTGGAGACACATGGAGAGAGAAGCTCTGCACATGTCACCG
ACGTGCATACATCGTCCTGCTTGTTGTTACTCTTGCTGTTGCTGCTGCATGAATCTTTTTCCGTGGCCACTTTGACTTACACAGGGTCTTTTTTCTTTTTCCTCTGCGGTGGCGTGTTCT
CTGTCCTTTGAGAAGCACAGTTTGCATTCAGTGTGATAGTGAAGCAGGTGCTGGGGTTGTCGCCAGAGGAGCCGGTCACTGCCAGGATACTGGAGGACTTCCTGGCCTTCATGAAGGGCC
TCATCTCCTTCCCTCTCTACATCCCAGGGACCCCATATGCCAAGGCTGTCCAGGTAAACCATCCAGACATGCCTTTATTAGCACACACTATGCTTACAATAAATAAAAAAACATACCATG
CTTACACTAATAAAAGATGCGTTATGATCATACAGTATATAACAGTGGTTTTTTCTGTTGTCTGCTGCTCCGATCCTAATAACTCACACAGGCCAGAGAGAGGATATCCAGCACTGTGAA
GGGCATCATCGAGGAGCGGAGGAGTGCAGGGTCATGCAAGAAGGGCGATTTCCTTGACGTGCTCCTGTCGAGCAATGAGCTCTCCGATGAGGAGAAAGTGAGCTTTGTGCTGGACTCCCT
GCTGGGAGGATACGAGACCACCTCGCTCCTGATCTCCATGGTCGTGTATTTTCTTGGACAGTCTGCGGAAGATCTGGACCTGGTCAAGGTAATACATGCATGATTTTCACTGTGAAGACA
CAGATGATTTGCTAGTAGCTAGGCCGGTGGCCATCAGTAAACTATATGCATGTGAATATGCTATGCACGCAGAGGGAGCACGACAGCATAAGATCCAACAAAGGGAAGGAGGAGTGCTTG
ACTTCAGAAGACTACAAGAAGATGGAATATACCCAACATGTAAGATGACCATTCACTACCTACTGTACAGGATTTGTTAGTAAGCAAGGGACCTTTTTTTTCCCTCCTGTCAGCAGCAAG
CCATACAAATGACATTTTTGTGGATATTCAGACTAGTTGTGTGTTTGTGATGCATATGTGCATGCTCTTGCAGGTTATCAATGAGGCTCTGAGATGCGGCAACATCGTCAAGTTCGTCCA
CAGGAAGGCTCTCAAAGATGTCAGATACAAAGGTAAATTAACAACCCTGCATCAGCACCGTATTGAGGCTTTCGTTGCAGATTCCATTTGTGCTCATCACATGATAATGGATCGGAGGCA
GAGGGGATGGTCGCACCTTTAAGCCTGATTTTTAAGCATTGTTATGCCTAGAAACACCTAGCTTTTGATAGACGAAGATGCTCAAAAGCAAGTGGCTCTCGCTTTTGCTCTGTTGCAGAG
TATCTGATTCCATCTGGCTGGAAGGTCCTACCCGTCTTCAGTGCTGTTCATCTGAACCCCTCGCTTCATGGAAACGCACAACATTTTCAGCCCTGCAGATGGGAGGTATGCTCTTTTCTG
TTCATGAGTAGTACTTTACCACCTGCCATGTATATTGGTAATGAACTAATGAGCTGATGATTCGCACAATCATATTTCATTCCTGTCAGGCCATAATTAACAGCTTAACTTTGTGATAAT
AAGCTACTTATTCAAACCTGAAATATATAATTAAAAGGCTAGAGCACCTATCAAAGAAGCTTATCTGGGGCTTTTAGGGAATCTTCTTTAAAGTGTGTACTCTTAACTAATTGCTGCCTT
TAATTAGTGAGTGTCCACCTGTGACATAATTACCTGCAACTATCCTGGTGTCTTCAGATGCCAAGCAAGCTGCCTGAGGCTGTAGTGCCTGTTGTCAATGGTCCTGGCCATGATTCCTCT
CATTCAAAGCCAGCATCCTTGGCTTTGCTTCACTATTTTTCTTTTGGTTTCTTTGATTTTTTTTTGAATGAATTCTTTGATGATCTTCATGGCTTGATTCATATGCACGCACGACTTATC
TGACTGCTGTACCAGGGCTCAAGCCAAGGGGCAAGCAAGAGGTTTACGCCGTTCGGCGGAGGGCCCCGGCTCTGCCCAGGATCGGAGCTTGCCAAAGTAGAGGCTGCTTTCTTCCTCCAT
CACCTTGTGCTCAATTATAGGTAAAAACAAAAGGGAATATTTGTCCTATCAGAGTTTGAGATGCATACACAAATCAGTGGTACAGTCACAACAACAAACCTGGCAAATCAAAGCAGCACA
TGAACATCGTAGACATTTCGATAACCGGCGTAACAAACTAATGCGGTGGGACGGATTTTTAAGTTTAAGTAGGGACGAGACAAAATGAACAGGAAATCAGAATAATGTGCTTATCGTTGG
GATTTAACCTAGAAAGTATAGTAACACATACTAGTACATGAACAAGGACGCAAAACAATGAGGTTAGCGGTGTCATACTAGTAACAGAAACTGTTGAAAGTAATAGCAAGAGGGTTGTGA
TGTACCATCGACAGGGACCGCAAGTCTTAAATTAAGTATTATGTAGTTGTGGATCCAGAACTGTAGAACATATTATCAGGCATGTCTGCATGGAGTTTTCTACAAGTAGGATATGCAAGT
TGAGTTGTACTGCTAACCAACCAGAGAAACAACATTATCGTGTGATCAAACTGCCAAATCTGGTTCATAATAATCTGCGACCATCTGAATATGACAAAGGACCTGGTATTGTTTTCCGGG
AGTAATAGAACTACCTACGGTTACCGAAGAACCGCTAGCTGATCATCCTTCCCCTCTCTTGAATTAAAACTTGGCGCCTTGCAGATGGAGAATCGATGGCGATGACGTTCCGATGGCATA
CCCGTACGTGGAGTTCCAGAGGGGTCTGCCAATAGAAATCGAGCCAATCTGCCCTGAATCTTGACTGGCCTGAAGGTGAGTTCGTCAGTTACAAGGCGCCTGCACGGGGGCCATCCATGT
CCATGAATAGTCAGTCGTTCAGCGGCTAGAGAAGTTTCGTGAAGTGAAGAAACACTGGGCACTAGCTTGTAAGTAGCTAGCATGAGGCAGCTGAGACTCTGATTTATGATGTACATGATG
TAGATATATTGGCAATTGCTTGAGGTGGTTGGTTCACTTCACCCTGTATTATTCTCTCCACTGGCTCAACTACTGTTCTATACGAGAAGATTGGGCTCCTGGGATTCGGAAGGCTTTTAC
TTATCATCTTGTGAGTTTGTAGACCTTTTAAGAGCGATATTAGCCAGGTATCTCGTTTGAATTTGGCCGAGCAGTCCCTTCAGGCTGTCAATCTACAGAGTAGAGGATGAGAGAAGCGTC
AGAGACGAACGCCAAGATATGGGGATCTTCTAAGACTTACATATGTAAAAATGGTAAACAAAACTCGACTGGAGTTTTTTTTTTTTTAAAGAAAAAGGCTACAGAGTGCAGACGCAGCTC
GCGCAGACCAAAACGTTGGAAAAAAAAATTGATTGGCCCATGCAGGTCTCGAACCTGCGACCTTCGCGTTATTAGCACGACGCTCTAACCAACTGAGCTAATAGGCCATTTTGTTTCAAG
GGCTGCTATTGATATATTTTAAATCATGAACCTAACATACTTTTACTCTACGATCTGGCACTGACAAACAACTGACAACAACATTTCATTCGAACAAAAGCTTCATCATGCATCAGTTAT
TCATAAGAACGACAATTTAAACATTCGTACATGCACAGCTTGCTACCTACATTCTCAGAAGAGTTCCACAAGCACACAAACTGGAGGGGACAACATCTACCATCTTATTGAACAGAAAAT
AACCGGGGAAGCAACTGGATCAGAGAAATCCATTTTAACATGTGCAGGGAGGATCAGTGATCTTTACAATTTGGCGACACCACTGAGCTTCAGGTCTTATGCTTGGGATATCAGGAAATC
TGGCTGATTTGTGACTGATCTGACCCATGCCCATTTGTGATCATTCACATCAACAGGGTTCTTCGCCACAGCAACGTCTTCCAATGGTATGTAACTGTATGTCCCATTAATCGGACCAGG
CACGAAGCCAGTAAACCCAGCCATGACCCCATGTATTGCCGAATGAGCCAGCAAGGTGCAGTACAAATTATCGGTAGCATTTGCCGGAACCGCTCGAATCATGTATGTAGGATCGATGTA
TTTCACAGTGAACAGTTCATCAGGATGCTCTTTCTTCCACCATCTACCCAGCTCAGATTTCAGCCAGGGGCCTACATCAAGAAACACAATGTTGCCAGACTCATCCTGCTCACGCTTCTG
ATCATCAGTACGGGGAATCAATTCCTGACCAGCTCCTTCAGCGACTACAATGACAGCATGCCCCTTCTTCTTTATCCGCTCATATAGGAACTCAAACAGACCTCCCTTGCCCTCCAGGTA
GAAATCAACCTCTGGAATCAAGCAGCAGTCAACATCACGGCTGCTCAGAGTGGCATGAAGCGCAATGTGTCCTGTACTCCTGCCCATTAGTTTGACAAGGCCTACACCATTGACAGCGCT
AACAGCCTCCACATGTGCTGCATCAATTGCCTGCTGAGCAATCTCCACCGCAGTTTGGAAACCAAATGACCTGTCTATGATGCCAATGTCATTGTCCACAGTTTTTGGGATCCCAGTAAT
GGATATGTCCAAACCACGGCGCTTGAACTCTTGAAAGATTGCCACGGCTCCTCTCATGGTTCCATCTCCGCCAATTGCGTATACCTTCAGCAAAGAACATGTAAATTTGAAAATGTTTTA
GTGGCAAGGATATATGGAAGGAATTACACAACTAGCACGTCGATTGTCAGCATACCTTCATGGTTTCATCCTATTGAGGTTAAAAAAATGCAACAATTGGTCATCTACTTCTTTCTTGCC
CCTAACTGACAATAACGTTCTATGACTCGTTAGGCTTTTCTGTCATACCCTGAGTAATGTGATTATGTGAATATCTAACACATATGAAACATAAAAAGGCCCTCAAAGCACTTTTTATAA
TGGTCATGAGGTATGATTTAACACTCAAGGAGAGTGCAGAAGTCTTAACCAGTTTGATTGAGATCTTACATTATTTAAAGCATATTTTTTAGAAAATAAATCCTCGCATCACCAATTCAG
TACAGCACATTGCGACCTTGCAGTCTAGAGGTAGATGGATAGACACAAGTAAATACTAGGTGACACGGAAGCTGCAATTGAGAGTTTCTGACCACCGTCTGTGTCAAAGTCTGAAAGTCG
TGCGCGCTGCGCTCACCTGCGTGTACCCGCGCGCAACGATGCCGTCGACGATCTTGCCAAGATCGAAGCCGCCCCGCGTGGTCTTGAGCACGGTCCCGCCCTTCTTGTGCCAGTCGTCGA
CGGCGGCCGGGTCAAGGCGCACGTGGTCCTCGTCGCCGCCGTAGAAGCCCCGGTAGCCCGCGGCGACGCCGAAGACGTCGCGGACGCCGTAGAGCTCCTGGAGGCCGACGACGAGCTCCC
TGAGCACGGTGTTGAGGCCCGGGCAGAGGCCCCCGCAGGTGACGAGCGCGGCGCTCGCGCGGGCCGGGTCGACGGCGATGTCCCTCCGGGGCCCCGCGCGGCGGTAGGCGACGAGCGGGG
ACGGCGCCGCGGAGGCGAGGTCGAAGAAGGCGTGGCGGAGGGAGACGTCGCCCGGGGAGATGTAGAAGGTGGTCGGCGGGTGGAAGTAGGGATGGCTTGAGATGGGGTTCTGGACCGCCG
GGGACGGGGAGGCCAGCGCGGCGGGCAGGCGCGGTACGTCGCGGAGGGTGAGCGGCGGGAGCGTCACGGTGGTGTCGGTCGGGCCCGTGGCGTCCGCGGCGGCGGCGTGGTGGCCGCCGG
AGGAGTTGGGGGCGGTGGGCTCCATGCGTCGGCGAGCGAGAGGGGGCCGCGGCTTCGTGGGCGGTGGCGAGTGGCGACTCGCGGCGAGGCGATCGAAGAGGACTGCGTGGGGAAGTGGGG
GTTTAACTAGCCGGCGACGTGTGGCGCTTTCGGCACTGAGGTTCGAGAAACTGTGGAGGCGCCGCGTCAGGGGGGCACGTCATCGCCCGGCGGCTTAAACTAAACGGCCAAACGGCCACG
TAACAGTGTCACGTAACGGAGAGCTGTGCGGTCACGAGTTAACGACGCGGCCTAATCTCGGGGTTGAGACGCCGTGTACACATACATAATCACCGCGAATCATTAAGTATAATATGGCCC
AGGAAAACAACACACGGCCCAATGTGATACCATACCACCTCATCAGCCCGGCCCATTCACCGCCCTGCACGCACGCCACCGCCTCCGCCGCCGAAGCCGAAGCACGCCGCCTCGACGGAA
TCCTCCTTTCTTTGGTGGCCATCCTCCATCGTCCTCCCCTCCCTCGTCGGCCGGTGGGCGCAGAGCGGAGATCGATCCGGACCTTGAGTTGGCTCCCTCTTCTGCTGGTAAGCGAAACTA
GGCTTGGCTTGCTTTCTGGCTTGGACACTCCGTTCGATTTGATTGCTGCGCGGAGTCACTCACTCCCCTCAAAACTCTGGGAATTTAAGTGAACCCCCTTGCCCCAAGCTCGCCGCCGGT
CCTGTTCCTAGTATCGTGTAGCACGACTGCACGAGTTTGTTGCGGCTGGGTTGGCATTTCTGTTGTTTGTTGATTTCTCCGGCTCGTTTGGCAGATCCATGGCTTACACGCCCTGTTCTT
TTGTCCAATCCGCCGTTTGCAGGGTACCATGAAGAGGTTGGTGTCGACCGCCCTCGTCGCGAGGGGGCTTGTCAGATCGTGCCGCGCGCCAACGACAGCGGTAAGGCTCGCAAATCCAAT
CACACCTCGAGGTTTCTCATTCGTCTGTCCTTGCTTGCTTCGAGTGCTACTGCAGCGAGATTGTTTGATACAGTTGTGATGATATTACTAGTTTTTACTCTCCTTATTCTAAGATAGTTT
TTCCTCTTTATTTCCTTCCTGAGTACTAGCACATCTGGGGTTTGGAATTTAGATCAATGTGACCTTGTGCGTGCATTATTGAATGGCTAAAGTTAATTTTTTAAACTTGTAACTCTGTAA
TTTGCGTAGCTTGCATACTTCCAATTCATTGGTTTTATTCCGAAATCGGGTAATTGAATAAACCTAGTAGTATACATGTAGTTTCCAGAATTTTCCAGTTCTCCTGTTCTGTGGCTTTTA
AGTTAACAGTTGCCATCATATGTCTGGACACTGTACTATACTAACTCCAGAAATGAGTGAATTTCTTTATTGCTACCTCTTTTGTTGCCTGTATTGATTTGCAAGTGCTTATCATGTCTC
AGATAAGGCTATGAGTGCTACAGTTCTCTCACGCACTACATGTAATTAAGATGTTCTTTGTCCCATGTCACATGACTTTAAAAAGTTGTGTGCAACATGCCAAAAGAGTGTGCGCAAATG
TACTAATGGGAAGTGGGGCAGTTTGTCTAATCTTGGCATAAATATTTTTCCCCTTCTGATCAAAATTGAAGGTTTGTTCTTTTATTACGATTATCATTCTCTGGTTGCAACCTTCAAGTT
TTCTGCGCAATTATTGTCTATGGAAACTTTTTACACCTCTGTTGAACTTTAATACTTGTGCTTTATGTGTGCCAATTTGATTTGTAACCTGTGTGATTAAGAACCAGCCAATTATAGAGT
TCTCCTTGAGAATATGTGATATGATGCATGAGTTCATATGAGGTAGTCTCTCTTCTTTTTTTTTTCTAATTTGGTTTTGAGAAGAAGGTTTGTCTCCATAAACCTGTTTAAAACAACACA
CCATTATACTTGATGTATTTACTGTTCTATTAGTGTTTAACTTTTGCACCTTAGGTAATTTGCATTTCCTTTTTAATTTTTGTGAATCCTTGTTTGCATGGTAACTGGAAGAGCAGGCTG
TGTCACGACCAGCTTTCCAGCAGTTTATGAACTACTCATCAGGACATGGTGGTGATGATCCTAATGCAACCGGGGATTCAACTGCAACACAAATAGCTGCTGATCGTGATACACATCAAG
ATTTCAAACCAATGAGCAAAAGTTCGGACACATCTTTGCATGACATTGTTGCTCAGGTATTTACATGTAACATGAGATTTCAGAATGTTTAGACCAAAGCTCCTAACTTTTTAGGGTTAA
CCATGGGGAGGGGGATAGTCTCCTTTTGATTCATTTTATTAGACTTCTAGCAAGCTGTAAAAATGCATTAGGGTTCTGTGGGTTTTGAAAATATGTTAATTTGGTAGGCATAACCTGAAG
CTTATTAATGTATCATATCTTGCTGCCATTTCTTCATTGTAACAGCAAATTTTCTTGGCAGGATATCAGGGAGAACCCAGTTTTGATCTACATGAAGGGTTTCCCTGAGTCTCCAATGTG
TGGCTTCAGCGCACTGGCAGTCAAGGTCTTCCAGCAATATGGTAAGTTCGCTTTAGTTAGTCGATTACCGATTTGTTTGAATTTCAGTCAATAACCAATGGCGCTTTCTAAATTTTAAGC
TATATCTTTCTATTGCAGATGTCCCTATCTGTGGTAGAGATATTCTGGGAGATCTCAGGCTCAAAGAGGCTGTCAAAGCCCACACGTAAGTGTCCTCTTTACACCTCCCGTAAGATGTGT
TCTTAGATGGCAAGCGGTTACAGTTATACATGTGCAGGGAAAACAATCTAGATTGAAGTAGCTCATTTAAATTTTGCATGATAGATACTGTATGAGATTATATGGTAAAGCCATGAAGGA
AATGATCTTCAAGCTTGCCTTCAAGAGGGAAGAACCAGCTTTAACCAAAAATTAAAGAACAAAAGATTCAGAATATGGTAGAATCAACAAAATGAGTTACAATTATCAGGTTGACATATA
GTTTTAAGCCTGCAAGGGTTGATTTATATCATCCTCATGTAAACAGTGTCAATATCAACTGTTTGTGTCTTGTGTAATGATATTGCAGGTTTCCTTTTTATCCATCTGAATTGCCGTGCA
CCGATATCTATGAACACCTTTTTTTTTTATCACACGCCATTCAGCATGCCCTGCCAATTTCAATATTTTTTTTTGTCTATGCAGTAACTGGCCTACATTTCCACAAATATTCATCAAAGG
AGAGTTTGTTGGGGGATCTGACATCATTTTAAGCATGCACCAGGCAAGTTCGCCTTTCTCATTTAATTTTGTTAGTGCATTAATCATATCATCTTAACCAGTGTCTGGTTCCTTCTTCAT
AATTTTCTTCAGAAGGGGGAGCTAAAGGATCTGCTTGGTGATATCACACAAAGATATGGACAAAAGCCGGATGCTAACGAGCCATAAAGGAATCCACGGTGCATACTTTTTCACTGTGCA
AGCTACTTTGTGACAATATTATTCTCAGACAATCATTAGGTGACCTTGCATGCGGTTATGTGCGGCACCGGATATGGATGTGGTGCCAGGTTGTTTAATCTGGCATTCTGGATGAGACAA
AACCATGATCGGAGTGTACCGAGTTCTTTGTCAGAATGAATAAGTGCCACTACGCAATTGCAGTTCTTTGGTGCATTTGTATATGGAGCTTTAGTTCATAGGTTGCGCTGCATTCCCATA
TTTTGTAATTCAACTGAACCTGCAATGACAGATATGGCTGTAAAATGCTTATGCGAAACATGTTCTGAATTCTGCCACCGTGATCACATAAACAAGTTGTGAGCTTGATGATTACTATTT
ACAAAAAAAAAATCTATGATTCTGAGTGGACTTGTACAAAAGTTATGTTTTCACTTTCACAGGTATTTGATATCAGTTGCAGCATGCATATTCACCTCAACTGTGTTTCGCTGTGAAACT
AAATTTAAAATCGATTTGTTTCCCTGGGTCATTCAATAAGACCAAACTTGTCTTCGGTACTACGCTTCATCGGCCTTTTGAAGATATATAAATGCACATTTCTATTATGCATAAAAGTTT
CGAGTTTCACGCACGCCTTTTTGAAGATATAAAGCAAATTTATATGTATATATTGGATAATTTTGTTTCATCTAATGAATAAACTAGTAGTAAGATTCAGAATCCCCAACATATTCATAA
ACAATATGCTACCAAACCATCAATTTGATTACTTTTATAGCAAGAAAAAACTCTCAAAATTGAATTTTATTTTGGTTGGGGTGTGCCAGGCCTAAGCAGCAGTGCAATGCTTAGGAGACA
CTTGAGAACTCTAGTGGCAAAAAATAAATTTAATATCATTGTGCTACTTGACCTACATATCAGATATTAATTGATAATAATAGATGCTACACTTGATCTTAGCCAAAAAACCGAGAAAGG
TATGAGTTGTTAGGATGGGGTACCCTTGTCTTATGTTCTCCTCCACCGGCTCATATGATCTCCCCTGGCGATGTGGTACTAATTATCAATCTGGAGCTTAGGTTACAAGTTCGCTTACCT
TTTTTCTTTTTGAGAAAAACAAGTTCGCTTAGCTAAACCAGGTTACCGTTGCCAAGTTGTTATGTTGGGCTTCGTCGCGTTGGGCGGAAGAGCTGCCTGTTTCTTTGTTGGCGGCTTGGT
GACCCACTTCACAAATGGGCCCGAGGCGTGCGGCCCAGATTTGCGATATACCTTCTGAGTTGGCCCATATAGGAATAACAAGAGCCATATCCAAAAATCCCTGCAAGCTCTCGACGCCAC
TGGTGGCATGAGCGTCCGGCTTCCCGGGGCCTCCAAGCCCGCCACCGCCATGGCCGCGCTGTCCCTCCCATCACTCCCCAACCGAACTCCACCTCCCGCCGCACCCGCCAGCTCGCCTCC
CAAGTCCACCTCCGCCTCCCTGTCCCTGAAGCGTCTCTGCAAGGAAGGCGACCTGCGTCAAGCCTTACGTCTGCTGACGGCCCGGGCGCAGCCTCCTCGGGAGCACTACGGCTGGGTGCT
CGACCTCGTCGCCGCCAGGAGGGCGGCCGCGGAGGGCAGGCAGGTCCACGCGCACGCCCTGGTCACTGGTTCCCTTGACGAAGACGATGACGGCTTTCTTGCGACCAAGCTGGTGTTCAT
GTACGGCCGGTGCGGGGGGGTGGACGACGCGCGCCGCCTGTTCGACGGAATGCCCGCGCGGACCGTCTTCTCCTGGAACGCGCTCGTCGGCTCATACCTCTCGTCCGGGAGCGCCGGCGA
GGCCGTGCGGGTCTACCGGGCCATGCGGGCGTCGGTGGCGCCGGGGTCGGCGCCCGACGGGTGCACGCTCGCGTCGGTTCTCAAGGCGTGCGGTATGGAGGGGGACCGACGCTGCGGGCA
CGAGGTGCACGGTCTGGCTGTGAAGAGTGGGCTTGATAAGAGCACCCTCGTGGCCAATGCGCTTATCGGGATGTACGCCAAGTGCGGCATGCTGGATTCGGCGCTGCAGGTTTATGAGTG
GCTGCAGGAGGGGAGGGATGTTGCGTCCTGGAACTCAGTTATAACGGGGTGCGTGCAGAACGGGAGAACCTTGGAAGCCCTGGAGCTGTTCCGAGGGATGCAGAGGTCCGGATTCAGTAT
GAATTCCTACACAGCTGTGGGGGTGCTGCAAGTTTGTGCGGAGCTAGCTCTTCTGAATCTGGGCAGGGAGTTACATGCAGCACTTCTCAAATGTGACAGTGAGTTCAACATCCAGCTCAA
TGCTTTGCTTGTCATGTATGCGAAATGCAGCCGGGTGGATAGTGCTCTAAGAGTTTTCCATCAGATTGATGAGAAAGACTACATATCATGGAATTCGATGCTCTCCTGCTACATCCAAAA
CGGTTTGTATGCTGAGGCCATTGATTTTTTTCATGAAATGCTTCAACATGGTTTTCAGCCTGATCAAGCCTGTGTTGTAAGCTTGACTTCTGCATTGGGACATTTGCGTTGGCTAAACAA
TGGCAGAGAGGTTCATGCCTATGCTATAAAGCATAGTCTTCATACTGATTTGCAGGTTGGAAATACATTGATGGACATGTACATAAAGTGTGATTCCATAGAGTGTTCAGCAAAAGTATT
TGAAATCATGAGCATTAGAGATCACATATCTTGGACAACAATCCTTGCTTGTTTTGCGCAGAGTTCTCGGCATTTTGAAGCACTGGGAATGTTCCGAGAGGTGCAGAAACAAGGGATCAA
GGTGGATTCTATGATGATTGGAAGCATTTTAGAAACATGTAGTGGTTTGAAAAGCCTCTCTCTGCTAAAGCAAGTGCATTCTTATGCTATTAGAAATGGGTTGCTTGATTTGATACTGAA
GAATAGGCTGATAGATATATATGGGGACTGCAGAGAGGTTCACCATTCACTAAATATATTTCAGACGGTAGAGAAAAAGGACATTGTTACTTGGACTAGTATGATAAACTGTTGTGCAAA
TAATGGGTTGTTAAATGAAGCTGTTTCCTTATTTACTGAGATGCAGAAAGCAAATATTGAACCTGATTCTGTAGCACTAGTAAGTATTTTGGTGGCTGTTGCTGGTTTGTCATCATTGAC
AAAAGGAAAACAGGTTCATGGCTTTCTTATCAGAAGGAACTTTCCTATAGAAGGTCCGGTGGTTAGTTCCCTTGTGGACATGTATTCTGGTTGTGGAAGCATGAACTATGCTACCAAAGT
ATTCTATGGGGCTAAATATAAAGATTTGGTTCTTTGGACAGCGATGATTAACGCTACTGGCATGCATGGACATGGCAAGCAAGCCATAGATATTTTTGAGAGAATGCTACAGACTGGTCT
GACTCCTGATCATGTTTGTTTCCTTGCTCTGCTGCATGCTTGTAGTCATTCAAAGCTTGTTGATGAGGGTAAATACTATCTGGATATGATGATGAGCAAGTACCGGTTAAAACTGTGGCA
GGAGCACTATGCCTGTGTGGTTGATATTCTGGGCCGCTCAGGCCGGACTGAGGAGGCTTTCATGTTCATTGAGTCTATGCCTATGAAACCAACATCGGTGGTGTGGTGTGCACTGCTTGG
GGCATGTCGTGTCCACAAAAACCATGACCTTGCTGTGGTTGCAGCCAATAAGCTTCTCGAGCTGGAACCTGACAACCCAGGCAACTATATTCTTGTATCAAATGTTTTTGCTGAGTTGGG
AAAGTGGAACGATGTCAAAGAAGTTAGAGCCAGGATGGAAGAACTAGGGTTGAGAAAAGATCCAGCTTGCAGTTGGATTGAGATAGGAAACAACGTCCGCACTTTCACTGCAAGAGATCA
CTCTCATAGAGACTCAGAGGCAATCCATCTGAAGCTTGCCGAGATAACAGAAAAACTGAGGAAAGAAGGTTACACAGAGGACACAAGCTTTGTCCTTCACGATGTGAGTGAAGAGGAGAA
GATAGGTATGTTGCATAAACACAGCGAGAGGCTCGCAATAGCATTTGGCTTGATCAGCACTCATTCAGGTACACCTTTAAGGATAGCCAAGAACCTCAGGGTGTGTGGTGACTGCCACGA
GTTCACCAAGCTGGTGTCCAAGCTGTTTGAAAGGGATATCGTGGTCCGAGATGCCAACAGGTTCCACCATTTCAGTGGAGGCGCTTGTTCTTGTGGAGACTTCTGGTGAACGTGATTTAG
GCCATAGAACTAACTACATAGGCATCTTATTGGCTGAGAGGTTACGCCAGAGGCAAAATTGGTGATGAGGCTAAGCGTTTTTAAGACTGAAATTGTCTGTTCTGGCAAGAGGCCCCCATG
GCCTGCCGTTCTGTGGACAGAGCAACCGAGAGAAACCATCTGTTATCAGTCATTTACAGTAGGGCTACTACCTATTTGGATTGGTGTTATGCAATGTAAATGATTCTTCTTTTAGCCATT
ATACAGTCACTAACTTTTTTTGTTAAAAAGATGTGCAAACTGGATAGTATAATAGCCAAAGAAAAAGAATACATGTTATTGTTAAAGAAACTTTTTCACCTCTACTGCACTTTTATACCT
GTGCTTTATGTGTGTCAATTTGATTCTGTTACCAGAGTTAGTAAGAACCAGAAAATTATAGAGTTCTGCCTCTTTTGTGAGTGTGATATGAATTATGATGCATGAGTTCATAGACTCCAT
TTTTTTTGTAAACGGGAAGTAGGTTAGAGCTGTGGTAGACTTGAGTCACTCAGAAGGAGAAGGAGAGTCTAGTGATGATGATGCTGAAACAAATTTTGTTGTTGTGCTAAGGAAAGAGAG
AAGCTCAAGTGGACCTATTGAGAAGTTCTACATGCTAACACCAGAAGAGGTTATAGCTGCAAGGAAAGGCAAAGGGCTCACCGAGAAGGTCCAGTCAAAGATTTCAACTCAGAAAAGAGA
AGAGAAGAGGGATCGTGCATGTGACTACATCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNA
TATAAATGCAGAACCCTAACTTATCCTTTCAATTTTCCCCATTTGGCCGTCCACCTGTCCCCAAGATCCCAGCCTGAAGCCTCCCAGGGTCCTCCCACCTCCCTCCCGACCTTCCTGCTT
GCTTGGGGACGGTGGCCACCATGCCCACCGTAGGGGGCTAGCTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNACCGTCTGCGGG
AGGCCGGTCGTCGCCGCCCTCCGGGGGCAACTGGAGCCGGCCGCCGCTGCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAGCCGAGTACATTTCAATTCTGTAATTCTGTACAATTCTTCTGTTATTTAATTCACACTTCACCACTTCACAATTTA
TATGCAGGTTTATAAAAAAAGAAATAAGCTACTTCATGATAGTATGAAAGATCTTGTCTTTGTTAAATTCAACTCTAAACTCAAGAAAAAGAAGGATGACAAAGTCAGGGACCCAATTTA
GAAGGCAATTGCTAATGTTCTTCTCGAGGACGATGAAAATAAGTGGCTCACTGGCATTGCGCCAAATGCTGAACAAGGACATGAAGCTGAGCAAGCTGGAGCATCATCAAAGGGAGAATC
TTCACAGGGAGCAGCAACAACACATTCCAAAAGAAAGAGAGGTATCCAGCTCCAGCGCCTTAGGAAGGGGAGGAAGATTGTTCCTGTCATGGATGATGAAGTGCAATCTGCTTCCTCTTC
TAAATCAGAAGATAATTTGGACATTGACATGCAATCTCTGTCAGCTTCTGATGAGGATGCTGACAAGTCCACCTCTAGCTCTGGTGATGATGAATATCTTTAGATATTGCAAGCACCTGT
GACCTGTGGGATGTTGAGACATGTATATGTTTGTTTGTTATTAATTGAAGTTGTTAGATTTTGCTTACTATTATGAACTGTATGTCAGTCCCTCTGTATTGATGTCAGAACTGAGAACTT
TTGCACTTGTGCTGTTTTATTTATTGTGTGCCTTGAAATGCTAGATGAAGTATGCATTCATTATATGTTGAAATACTTGCTGAAATTCCTTGTTTTGTGGCTATATATGGCATGTTTTTT
TTTGAAATGCTATTTGCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTAGTTAACTAAGCAT
GCCTCCACTAAAACATTAACTAAGCATGCCTCCGCTAATTTTCATAGCCCGCTATTTAGAACATTTTGTATCAATTTCATAGCCCGCTATTTAGAACATTTTGTAGTTAACTAGGGGAAG
GGTGGTTGCCCTTGCCTCCACTTGATTCATTTCATTGTGCTTCCATCAAGCTGTGAAAATACATTATGGTCCCGCAACTATTAGAGCCTTTTTTTAGACAATGAGAACTTTGAAAAAGAA
TAATGCAAATATTCATGCACAAAAGTTAATAGATTTTATCCTAGTTACTAATGTAGCCTGTGGTAGGATTAGCACGTATAATAGGTTGGTAAGGTGCTTAAGTCAAACCATCAAAATTTA
ATTTTGTTTTGGTTGGGGCGCGCCAAGCCTAAGAAGTAGTGCAAAATTTAGGTGACACCTGAGAACCCTAGTGGCAAGCCACTATGATGAGCTCTCCCAAAAAATAAATTTAATATCCTT
GTGAGTGCTTGACCCACATATCAGATATACACTTGATCTTAGCCAAAAAGCCGAGAAAGGTATGAGTTGCTATGCTGAGCTACCCATTGTTTTATGTCCTCCTAAACCGGCTCAAATGAC
CTCCANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCTTTTGGT
AGGAGGGATGGTTCGAATAGGATAGACGTGGTTCTAACACCGTCTATCCTATGGGACTTGCGTGTCAACCTACCTTTCCCATCATCTTCTTCCTCTGTTATGTCCCACGGTCGTCTGTAN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTACCCAGCGATGTGGTACTAATACTAATAAACGATCTGGAGCTAATTACGGGTTTGCTTAGCTAAACCG
GGGACAGGTTGTCATGTTGGGCTTCGTGTTGCGCTTGCGCCTAGCCGATGAACGAGATGGGCTATATTTTTCGCCACACGATTTAGCAGACAGGACTGGGTGGGGCGCGACCAGATTTAT
AAATGGGCCCCAGTGTTGCGGCCCATATTGTGGCCCATTTTTCGAATTAGGCCTTCACGTGTTTAGGGCTCGGGCGGGACGGCCTGCCACCAAGATGGTCATCGTAAAAATTGGGATGGT
CAGACCAGTAAAGGTAATGTCCGTTCGCGATTGATGCTCGTTCAGGGAGAAGAAAGGAAAGAAAAAAAAGCGCGCGGTTCGTCTAGATCTGATGAGCTGCTGCTGCAGCACACCTGAAGC
AGGCAGGCTCATGTTCGGCCGTCACGCGCCGGCCGGCGAGCCGCTCCGCTACCGTCGGAACGCTGCCATGTTGGCCACTTGGCCGGCCTATTCAGTGGTGCAGAGCGCAGAGCCACATGT
GTGTTCCAAGTCTGAACCATTCGCTATCCAGCGCTTGCAAACTGTGATCCGAGTTCGTTAGGCGATGACCGGCGACCGCGCCGGGAGTCCAAGAAAAGGCCCACGGTGTNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTAGGTTTCTGTTGTCCGAC
TCCGATGATGCCGAGTGTTATTGCTAAAAAATGGTTCCGAGTGTTCCACCATCCCATCCCACTTTCGAGTCCAAAAGCTAGCACTATCTGAAAATGGTTCCGAGAGGACAAAAAAAGGAA
GAGCCTGCAAACCATGATTTTGGAATACTATATGGTTGTACTAGCATAAAACTAAGACGAGATGGACAGGGCCCGGCCTATTCTGGTTGTCAAGAGTCAGGGCCACTGGTTAGCTCCGCT
CCACTGTACGGCGACTCCGCGATCGATTGACTCGGTTTGCGCCCGGAGCCGCGGCTTCCGAGTTGACCCGGCCCGGAGCTGCGCAAGTCAAGTCTCTCGACCCCTAGTAGATCTGAAACC
TCACCAAGTCACCAGTCTCGAGAACGCGTGAGCTAGTTAGGTAGTTGCACTTGTCAATTCGGGGCCTCACCTGCTAGGAATGTTCTTACGCCATGGACGATCCTCCTTTTGGCCTTGGCT
CGTCTGCTCCATCGCCCCTCCTATATAAGAGCTCCAAACCATGGTTGGCTCCCTTCACAAGCCAGCTCTTGGTTGCAGGCACCTCAAGGGAAAAAAGATCGATAGGAGTAATTAAGCCAC
CCGATCAGACTACTCGCTCTGCTGATCGATCGCAACTGTTTCCCCAGTTCCTCTTTCGACGCAGCAACCAGAAGCAAGCGATGAAGGTAACTAGGCAGGCAACCAGCCACTTGAAACGTC
TCGCTGTAGCTCTTTCGCGTTCCTCTGCTTCGTGACGATCGACGCTGATAATTTGCTCTGTCCCGTGGCTCTTTGTTGCAGCAAAAGATCGTGATCAAGGTGAGCATGTCGTCCGAGAAG
AGCCGGTCCAAGGCCATGGAGCTCGTCGCCAGAGCAGACGGTACGGACGCGCCCCCCGGCCACGCATGCTCAGTTGCTTCTCCTAGCTCTCGTGCATTCCTTTTGGCCGGTGCTAACGGT
TCCAATACGTGTGTGTGTACGCAGGGGTGAGCTCGATGGGGGTCACCGGCAACGGCAAGGACCAGCTGGAGGTGGTCGGCGACGGCGTCGACACCGTCTGCCTGGTCAAGTGCCTGCGCA
AGAAGCTCGGCCACGCCGACATCCTCAAGGTGGAGGAGGTGAAGGACAAGAAGCCCGAGGAGAAGAAGCCGGAGGAGCCCAAGGTCGTGGACCTGCCGCCGTATTACTACCCCGGTTACT
ACTACCACCACCACCATCTGCCGGCGCCGTGGTGGTGACAACTGAAAAGCCCAGTTTTTGCAGTAGTAGTTTGATTCATATTCGTTTCATTCCATACTCGTATTTGTTTGTGCGAGGGAA
AAGCTATATATAAAAGAACAGTTCTGCAATTGTCCGTTCGTGTGGAAAATTTGATTTCTTTTATTACGAGACCCGGGAGCTCAGCGAGCCTCGCGGCATGGTGTATGGAGTGAATGTAAT
CACGTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCGTTATC
ATAGAGTTTAACTGATTCTAGTTTGATTGCCCAATGGTTGGACTCGAAAACAATAGTCGGTTGTCGTGAGTTAGCAACCCAGTTAAGTTCCCGTAACGGATCCGTGTGGATTCATGTTGC
ATTGAAACCCTTTCTGAAAACATATTTTGTGAATATGTCTAGTGAAGCATATTGCTGTATTGCAATTGCAACAATAGGACCTGTTTCAAGGGCTATGACCTTTGGCACGATTGGTCATGG
TCCATGACACAACACCAATACCTCTTGCCAATGGTGGATCCACACTTTTTTTTTTTTGAAACTGAAGATCCACACTTTAAAATATGGATCCTATGTTTTTGAAGTTGCCTGATAGGAGTA
TGCTCTAACACCATGTACCAATGACGTTATTTCCTTCAGTGTGGTCAAAGGATCCACTCTTAATAATTTTTTGTTAAGGTTATATTTTTTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNGGTATATATTCGTACAATATATTTTAAAAAAGGGTCATTTGCAAAAACAACCAACCCCGATTGGGCATGTTTTGTCGTTATGTGTTGGTGAACTGGTTGTTTGGTATTT
GGCTTCTGTCTAACAGTACTATGCTGTCCTCTTGCTTGACCCGTGGAGTGGAATATTTCTCTGATGAACCATTCAACGTTTGCGCGGACTACTACCCAGTTGGGTCGGTGATGACTGTTG
AGTGTTGACTGCACCGCGAGTCCAAGAAAAGTCTGAAGGGACTGTGACGCTTCTAGAAGAGGTGAATTTGGTGTTCTTAATTTAAATCCAAGCNNNNNNNNNNNNNNNNNNNNNNNNNNN
NCTAGATGTGCACTAGGTTTTTTATGGTGCTATCTCTACTGCAAAAGAGTTGCACTAGGTTTTTTATGTTGCTATCTCTACCGCAAAAGAGTTTTGCACGCTAGGTTCCAATCCTATAAA
CTACACATCGTAATTTTAGGAAAGATAAACGCGGAATGTAAGTGAAATAAGAAATGCGGAAGGTAAATGAGGTAGAAAAGACAAACTCCCGGTGTGGTGACAAGGAGATTTTTACCGAGG
TATCGGAAAGCAAACATTTCCACTAGCCCTCGTTGTTAGAGCACTCTCAAAGGGAATGCCTGCGCAAGGGTATAAATTCCTCGGTCAAGTAACTCTGTAGGATAGCCGACGGTCCTTCCC
CACGCGCAAGTGGGTCTCCGCCTAGGCTCTCCCGGATGCTCCTTGCCGCTCTTCACTTGGTAGAGCTTCGGGAAAACACCGAGGGCCTCTCTCCCTCTCTCTCACAAGCACCGACGACCA
CTCCACAAACGTGGTTGGAGGGTCTCACAAGACTTATAAGTCCCGGATTTACAACTCCTGATGCGCACAAGCACCGGTACGATGGAGGTGTGCAAATCTCGCCTAACTCTAGACTAAACT
CCAAAGCAATGCGCTAATAGATCTAAAGTAGCACTAATCAAGATCTAAGCCTTATGCTAATTGCCTTAATCTTCTCTTTAGCACTTTAGTGGTTAGATCACTTGTGTGTATGTGAGAACC
AAGCCTATAGCTTCTCCAAGCTCTAACACACTTGAAATGGCCGGTGTTGACGCTCATTATTAACACACTTTTAGTGTTATTTAACTACTTATTTCATACTTATTCTTATACTAACCCGCC
ACTTGGCACTTGAAATAACCCCATTATTGCATATATGTTATATCTTAGAGCATATTGTATTTTGGCAGAAAATACGACATAATGAAGGGGGTTCGTTTAAAGAGCTTAATGGATATTTGG
ACATGGGTCGTCGAGGGAAGCCAGCACGAGGAAGGAGAGGACCAGAAGGGCCCAGGCCGATCGGCCTGGGACCCTTTGGGCTGATCAGCCTGACCCATTTCAGGGCTCGGTCGACCTCCC
ATTTCTTCAGTGTGAAGTCTACGATGATCTCTAGATTTTTTCATCAACATTGACCCAGAGCCACCGCCTATTGGAGACTATAAATACCCCCTCATGGACTTCAAGGAAGGAGAGTTGGAG
AGAAGAGGAAATCACCACACAAACACCATCCACCGCCGCCACAAGTAGGAAAAACAGAGAGAAGATTCGATCCAGAGGAGGCCACGCGAAGAGGAGCACCAGGAGGGGAGGAAACCCCCT
GAGCCGATAGGCTTAGAGGTGCCCAGGCCGATCGGGTTGGGTCTTCTCTGCCCCCACTCATCATCGTCTTTGGTCCAGTTGATCTACCGGGCATCCTTTACCCCAAAATTTGTCAACATG
TGTAAGATCATGGGGTAATACCTCTATTTGTCCTCAGGGTTGTATGGAGATCTTAATTTGTAATCGCTGAACCTTTGGTTGAGATTTGTTTTGTTATCAATCATATCTTGATGACGCTCT
TTCATGTAAAGGATGGCTAGCGCTACTTTAGGTTGCTTATTTGTTTACCTAGAATAATCATATTGACGTGTTCTTATGTTCCGATTGTTGAGTACCCCTGTGTAGTGATAGTATTGCGGG
TGGGAAAATGTTGGGCATGGTTCACAACCACTCATGATAACACCTAGATCTAATTCATTCATGCATGGCGATTGCATCTACAAGTGATTCTAGATCCCTAGGACAAGCGTTTAATCTATG
TTGTTCACAACCTTTACTCTCTTTCCATCTTAATCTAGATTGCTTAGTTCTTTTGTTAGAATAATCATATTCTATTCAAAGAGCTTTTGGTTACATCGATTAGTACTTAGTTAAGCGTGC
AAATCCCTTGTGCCGTAGATTGATAAACCTTGGATAATCTCTAAGGGAAAAGCTACAACTGATCTATGCATTTGCGGTTCACAATTTGGGGGGCTAACTGCCATCAACAAGCTTTTCTAG
TGCCGTTGTCGAGGAACAAGTCAATTTTTCTACGTTTAACTTAGTATTAATTTTTATCAACCTCTAACGTCTAACTTTTTCTCTAGAAAAGAAAATTATTATTTTTGTTTTTGGTGTCTA
GATGGCTCTAATCAATCACTACAAGGAGGAAGGAGAAAAGTCGCCAAGGGACTATGAAATTCCATTAACCAATCAATTCGACATGTAGAAATCCAACTCAGTGCTTGCAGCCAAGGAGTA
CGATCTGAATAAAGGAATAATCGACATGGCTAAGAGCAATCCTTTCCAAGGAGTGGAGACTGATAATCCATACAGACACATTGAGCGATTCACGATGCTTTGCAACACGCTATAACAAGA
AGGAATTCCACCAGCTTGGTTCAGGTGGAATCTGTTCCCGTTTTCACTTGCAGGTGAAGCAAAATGATGGTATGCAGCAGCTTCTTTCAATGCGAAGGGGAATTGGGAGACACTAATGAT
AAAATTATGTGGGAGATTTTTCTCTGTGAGCAAAGTTCAAAACCTTCGGAAGGAAGTAATCATGTTCGTGCAAGGAGAAGATGAAGGAATAGATCAAGTTTGGAATAGATTTAGCAGACT
ACTCGAACAAGGATCTAAGCTTAAATTCTCAGGTGATGTGTTGTTGCATACATTCTATTTTTTACTAACTCAAAAATGCTGGGAGTTTGTTCAAATGTGTGGAGGAGGAGATCTTATGGA
GAAAACACTCAGGGAGGCCGCTCAATTGTTACAGAAGATCAGCAGATGAGCAGCTATAAACAGAGAATGGGATAGTTATCAATCTGGAGCGCACTAGCAAAAAAACCAACAACATGAGCT
TGCTGGAATTTTCAGAAAAGAACTTCAGGAGGATGCAAAAGAAGAACCTGTGGTGCAAAAAGAAGAAGGACCGGCACACATAAAAGAGGAACCTACTTGGTGCATCAAATATGACGAACA
AAGAAACATCAGAAGTTTGAATAAATGAATTGGATTCCTATTGACTTCAGTTTGATAAGCATAGACCATATCCAAATCAAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGCACTCCTATCTAATTCAACCCCACAGTTCGA
CGTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCTGGTCACGTCTCTGAGTCTTTACGCCTTCGGCTGTCCANNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCATTCCCAAATCTAAAGGGGTCGGCTAGAGCTGTTGAGACAGATTTT
CCACTGGAGAGAAACATTGGCTATGTGCTTGACAAGGAGACAACTGGAGAGATAATTCAAAAGCTCGTTAGTGAAGAAGAAGTAAACCCAGAATATGTCACTGAGGTGAAGAGAATCATG
GGAGTGAAGCCGGAGGCATCACCATTTTCTAGACTAGGAAAAGTATACACGATTGGGGCTAATCAAGATGAAGGAGAATCTTTGTCTACACCACATATCAATTGTATGATTCATGGGGAG
ATCATCTACAAAGCGCTTTGCAACATTGGAGCACATGCAAGTGTTATATCTTTGAAAGTTTATCATGAGCTTTATAGTAAAACTTTACAGCTTGCTCCAACACCGATAAATTTAATCATG
GGAGATGGTAGAACGACCAAACCTCTAGGTGTCCTTAGAGATCTAGATGTTGCTATCTCGGGAAAAGTTCTACCATATGACTTCTTTGTTATTGATGCTTGCCATGATGAACATGATGAT
ATTATCCTTGGTAGACCTTTTCTTAAGTTGGTTAATATTGTGCTTGATGCTGGGAAGGGCAAAGTTCCGATTAATCTTGACGGTGCTAAATACACTTATAATTTTCTACCTGCTTCTCGA
CAAATCCTGCCTCTACTTCCTGATAACGAGGAAGTAGAAAGTGTATACTTTGCTGAAAATTTCAGAAATCCTCTACTAAGAGTGATGGAAAACAACGAGGATAGTCAGGATGATGAACTA
GGAGAAGCAACCGAAGCATTATCACCGCAATATGGAACTTTAGAAGCAGAAAAATTTGAAGACATTGGAGATTTAGAGCAGCAAGAGCCTGAAGAACCAGATGTTGAGCAGAAGTCATTA
CACAAGGGATTAAAATATGAATATTTAGGGAACAACAAGACATATCCAGTCATTGTTAGCGACGAGTTAAGCAAGGAAGAAACTGAGAAGCTGCTGAATTTATTAAGAAAACATCAGAAA
GTGATTGAATATAGGATCAAAAACTTGAAAGGAATAAGTCCATCCTTTTGCACTCATCGAATACAATTAGAAAATCAATACAAACCAGTTGTGTAGAACCAGAGAAGATTGAGCCATGCT
ATGCGTGATGTAGTAAAGAAGGAGGTGATCAAATTGCTTAATGCTGGAATAATCTATCCAGTACCACATAGTGAATGGGTGAGCCCAGTGCATTGCGTGCTAAAGAAAGGAGGATTGACT
ATTGTGACAAATGAGAAGAATGATCTAATTCCTCAGAGGACAGTGACTATCGAAAGTTGATCTAATCCCTTTGCTTGTTGTGTATTGACTATCAGAAGTTGAACAAGGCAACTAAGAAGG
ATCACTTCCCTTTGCCTTTCATTGATGAAACACTTGAAAGGTTAGCAAAACATTCACACTTTTGCTATATTGATGGATATTCCGAGTTCCTTTAAATTTCTATACATCCAGATGATCAAT
ATAAGACCACGTTCATCTGTTCCTACAGAACTTTCACTTATAGAAGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAATCAGTTATCAACGCACCGATCATTCAACCTCCGGATTGGAATCTACCTTTTAAGATAATGTGCGATGCGAGTGATTACGC
TCTTGGAGCAGTCCTTGGATAAAGAAAAGAAGGGAAGGTACATGCAATTTACTATGCTAGAAAGACATTAAATGAGGCTCAAATAAATTATGCAACTATAGAGAAGGAATTGCTTGCCGT
AGTATTTTCTTTTGAAAAATTCAGATCATATATTGTGAATTCTAAAGTGATTATGTATACCGACCATGCTGCAATTAAATATCTTTTGTCCAGGAAAGATGCTAAACCACGTCTGATTCG
TTGGATATTGTTACTTTGATGTGGAAATTAGAGATAAAAAGGGGTCAGAAAATATGGTAGTTGACCACTTGTTAAGGATGTACCAACAAGATGATGGGATGGAGCCAATTGAAGATCGAA
TGTGAGATGACCATTTATACAGAATACTTGACAAGGATGATTGGATGCATGACATTATTAGAACAATCAAAAGGGTGCCTTTGCATCACTTGGATAGGAATGAAAGAAGAAAAGTTATTG
CTGAAAGTAAGAAATACTATTGGTCTGCACCATTTCTATATAGATATGGAGCAGATGGAGTATTGAGAAGATGCATTCCTAGAGAAGAAAGAGACGCGGTGCTTAGAAAATACCATTCAT
CAGAATATGGAGGATATTATGGAAACTTTAGAACTCAAGCAAAAGTATGGGCAAGCGGANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNGAACAGGAAATATTTTATCTAGAAATTCTATGCCTTTGGACTATAATTTGCAAGTGGATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTCGAAAGGTATCAACGGAGGAATCAATTCACATGATCAAGACGATGATATTTCCTAGGTAAGGAG
TGCCTAGAATAATGATAAGCGACAGAGGATCGCATTTCATAGGAAAAGATTTTGGCAAATGTTTGAAAAAATTGGGGATTGAACATAGAATGTCTACAGCTTATCATCCTCAAACAAATG
GCCAAGAAGAAACTTTGAACAAGCAGCTCAAAGATACATGGAAAAAGACCGTAGTCAAAGGAGGGAAGGATTGGTCAAAGAAACTAGACGGAGTATTATGGGCATATAGAACAGCTCATA
AAACATCTATAGGTATGACCCTGTATCAATTTTTCTATGAAAAAACATGTCATCTTCCCATTGAATTTGAACATAAAGCTTATTGGGCCATAAAAGAGATGAATCTTGATGTTGATGTTG
CAAGAGTAAAAAGAAGCATTCAAATAAGTGAATGAGAAGAGATCAGGCTTAAAGCTTACCATAGTTCAAGCATTTACAAGGAAAGAATTAAGAGATGGTTCAATAAAAGGCTTCACAAGA
AGGAATTCAAAAAAGGGGATAAAGCGTTATTGTTCAACTCCAGATTTAAACTCTTCGGTAAGGGAAAATTAATGAGCAAGTGGGACGGACCATACATGGTTCATTCTGTGTCACCTATTG
GAGCAGTAACAATCATGAACGTCAAGGGAGATCAATATATTGTGAATAGACAGCGGCTAAAGGTATTATTGGAACCTGATGTCGTGCCTATCAATTATGTTTACGTCTATACCATGGAGG
AAGAACGGCCACGTCAAGCCCGACGACACTAAGGGTGTGTTTGGTTGGANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCTTTTGAATAAATTG
TTGAGTGGACCCAACATGTCATCCACAGTCCACTCCACTCAACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGACCAACAGTTCTCAT
CTTTCGCTTGGGATGAACAGACGAACGAACGAATCATGTTCTGCAGCAGCAACCTCTTCAGCTTAGAAAGGGCATGGATTAAGTTATTCTATAGAAGTGTCGTAACTTTCGTCCAAGCTA
ATGATTCATCAGCCATCAAGTTGATTAATCCTCTGTTAGCGAATCGCCAATTGCAACTTTGAGAACAGTACTGAAGGAAATATCCCGATTTCAATTAGCGAAACTAGGACACCTACTCAT
GAACTCAGTAATGTCTTACTCAAACATAACCTGCACTGGACCAATCGATCGGAGCATTGCACGATAGAAGCAAATGTTCGATGGGTAATCACTACGGATCGAGCGGGTAGGCGAGCTCCT
TGAGGACCTCGGCGAGCGGCTTGCTGATGCCCTCGGTGGGGGCGGCAAACTTGCCGCCGGCGAAGTCATTCTCCTCCTCTGACGGGAACTCCGGTTCCTGCGGGAGCCATGGCAGGGCGG
AGGGACGAGGGAGCTCCGGTTCCTGCGGGAGCCACGACGAAGCACGGTGGCGGAGCCCGCACCGGGCTTCTCTCACGCGCCACAGAAAATGAAGGAATCAAACTGCCTACTCTCACACGT
TGGGCTTCTCTCACGCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTAAAACAGGTACCTTGTACATACTCTATCTTAAATTCTATTATTTTCTTTTGAATT
TTGTGTGGGACTTGAAAAATTAGATATATTTTTAGATGTACGTGCTGCCATAAAATTTTGGGAGTCAGAGGGGCTGAAAACCCCCTAGGACGATCAGCCCAGTAGCCCCCAGGCTGATCG
GCTTGGGAGGTTTTAGCCTCTGATTCGGTTTCCCTTTCTCATCTTTGGTAACGATAGAATATGGAAGTGAATTTTTGCGGGAAGGGGCGAGGAAGTTTTTGGAAATGTGTGGATCCTTAG
CCAAGACTTCAAGAGTATATAATGAGGTCAATTGGAACTCAAGTTTCGCATCTACACAAGCAATTCAGATCCACTAAACCAGAAAAAAAGTGCAATGGCGACATCCAGGAGCTCAGGAGA
CGAGAGGGGGTAGCAGCTGGCGAAGGAGGAGGCCAGGCCGATCGGCCTGACCTCCCCAAGTCGATCGGTGGCACCGGCCCCCCTTGGCCACAGCCTTCGCCCTTCACATGAAAACCAAGA
GGTGCGAGTGGGGTCCCAAAACTCCGCTAGGGACCGCTCATAATGCTCGCATCAGTGTTGGAGGCAAGGCGCCATCTGGAAAGCTTACAGATCGCAAGTTGATCATCTTCTCGAGCGAAG
ATGAAGCACCTAAGAAGAAGAAAGGGGTCGTCGTTCCTCCCATAAGGCATTCAGCAAGGCTCCTCGGGATGAAGCACAAGAGCTACATAGAGAAGATGCCCAAGTATACGCCGACTGACT
ATGGAGGTGATAGCGATTGGGAGGACGATAGGAGCCCCAGATCGTGGGGTGTTGCAGGATGTGACAACGAAGAAGATGCTAACACGTACTGGGATTAGGCTGATGAGATGAAGAAAAGCA
AGGAGCAAGAGGACCGCCGTCAAGACAAGGGCAAAGAGAAGGATCTAGAAGATGACAGACTAGAATCAAAGGAGCATGATGGTACGTGTTGCACAGCTTGCAGGAAGAACATCCACTACC
TCTTCGACGCCGTCGATGACATATCCAAGCCTTGCAAGCTTTGGATATAAATGCAGAAGATAATGATCGCTGTCAGGAGGATGACTTCAAGTTCTTGTAGAGGAGTGCGAGGAAGCTCTT
CGGGATGTGCAGCAACATGAGGAAGAACAGAGCTCATGGCAAAGGAAGCAGCAACCATCCTGTGTGCAAGCAGTGCAGGCAGCGTCACTAGTGCGTTTACGAGCGTCTTTCCCTTTGTAC
TTCATATGGTTACACCGAGGACGCCGTAGATTTTAAGTGTGTGTGTGTGGGGGGGGGGGAGAGATCATCACTCGTATGAGTTTTTGGATCTAGTTTGGTCGAGTCGAGTCGTGTGAGAGT
CTAAAGTAGTATTTTTTTATTTCAATCAAAATTAGATAAAGTAGTAGTCTTCTTAAGCTTCTAGGAAGACTGAGGCCTAGATTGCTACGTTAGTGTCTTTGTGAGAAGAAGCATGAATAA
AATTTGAGGATCGTGCAAGTGTTTTTAGTGTCTACCTTGGCTTGCTTATCTTTTATTTTGTTTTTGCAACTTTGGACCTGAGCATTGTCTTGAATTCTAAATCTTAGTTGTGGAGTTTTA
GTAATCAATTTGTTTATGCAATACCCATGCTTTATGATGATCAAGTGCTTCGGTTTTGATTATGCTTTATGAGTAAGGTCTGAATTGGAGGTGATTTAAATTTTTATTGTTTATTTAAAA
CCTTTGCAAAAACAAGATTGACCAAGATCTTCTAACCAGGTTGAGAGTTTTTATTTATCCTACCCAATGCCTAAAAATATTTGTTCATACCACCATAAACAAGATTTGACACTTTGAATT
GAATTAGGATCCCTCTATCTTGGTTTGCTATAACTCTGAGCATTGATCATATCCTTTTTACCATCTCTAAATGCTAGCCTCGTCAATATTCAGTAATGAGAGTTCTTCATTAGAACAATC
ATATTTTCTACTGAATTCCTTAACCCGAACCATAAATTTCTTAATTTTATTACCTATTCCTTGAACACAACCCATGATATGAAGATCTATTCCATTTCTAGTCGAGTATGAAATTTTTCG
AAACATACAAGATAAGGAAGCTTCACCAGAAAAAAGAACTAGAGGGGAGGAAAGGAGAGGCTAGGCCGATCGGCTTGGGGTCTCCTTGCCTTGATTTTCGCACAGCAAATTACTAGAAGG
TCTTTGGAAGGATCTAAAACTAATTTTATGGTGTGGTGTTCAGAGGAGAGGTTCGGAGAAGAGATTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTTTTTACTGTCATGAAGATCAAGCGAGGTGCAAAGAAAAGATGAACTTTATTTACTGAACGGATTTTCATTCCAACCAT
GTGCAATCCGACGACTAGGACATCGCTTGTGCCTTAGAGTCACTATTTTATTTGCCTTTGCACATATCTACCATTCTATATATTCTCATCCTTGAAAACCTCACATTATGTGGATATATT
TATGGTCATTGTCTTGGAAGGTAGGCAACCATTAGTTTTCTTAATTTGATAATATAAGTATTGATTCTAGCTAGCCTTACCCAAGCTCTGCCATATAATTGAGTGACTTTTGAGAGGTGA
GAGCTTGCAAATAAGTAGGATAGCCACCATTCATTTGAGCGACATGTAAGCACCTGGAAAAGAATTCTTGTTTCAATTTTGTTGCAGGGAGATTGTTTTATAATGAAAGAAAAATCCTCC
GAAGAAAGTCAGAAAGTAAGTGTTATTGATTCTTGAAGTTACTTGGTTCTAAATAATAGCTGTGGAGGAATCTTTGCTTAGATAAATCTTTGAACACCTATACTTTGATTATCTTTCTTG
CTCCTTTGATCTTTCATTTGAAGGCTAGGTACTTGACTCGCTTGCTCCGGTTTAGTTTAGGATCTTTGTTCAACACTGCTGGAGAAGTTTATAGTCGCTTGACCTGCTCAAGGACGAGCA
AGAGCTAAGCGTGGGGGGATTGTTGACACTCGTTATTGACACACTTTTAGTGCTATTTAACCACTGTTTCCATGTTGATTCTTATACTAACCCGCCACTTGGCACCTAAAATAACCCCAT
TATTGTATATGTGTTGTATTTTGGAGCATATTGTATTTTAGCAGGAAATACGGCATAATCAAGGGGGTTCGTATAAAGAGCTTAATGGATATTTGGACATGGGTCATCGAGAGAAACCAG
CACGAGGAAGGAAAGGACCAGAAGGGCCCATACCGATCGGCCTAGGACCCTCTAGGCCTATCGGCCTAGCCCATTGCAGGGCCCGGTCGACCTTCCATTTCTTCAGCGTGAAGTCTACGA
TGATCTCTAGGGTTTTTTCACTGATATTTACCTAGACCCGCCACCTATTGGAGACTATAAATACCCCCTCATGGACTCCAAGGAAGGAGAGTTGGAGAGAAGAGGAAATCACCATGCAAA
TACCATCCACCGCCACCACAAGTAGGAAAAATGGAGAGAAGATTGGATCCAGAGTAGGCCACGCGAAGAGGAGCACTAGGAGGGGAGGAAACTCCATGAACCAATCGGCTCAGAGGTGCC
CAGGCCGATCGGCCTGGATCTTCCCTGCCCCTACTCATCGTTGTCTTTGATCTAGTTGATCTACAGGGTGTCCTTTACACCAAAATTCATCAACATGTGTAAGATCATGGGGTAATGCCT
CTGTTTGTCCTCAGGGTTGTATGGAAATTTTGATTTGTAATCGCTGAACTTTTGGTTGAGATCTGTTTTGTTATCAATCATATCTTGATGACGCTCTTTCATGTAAAGGCTAGCTAGCGC
TACTTTGGGTTGCTTATTTTCTTACCTAGAATAATCATCTTGACGTGTTCTTATGTTCTGATAGCTGAGTACCCCGTGTAGTGATAGTATTGCCGGTGGGAAAGTGTTGGGCATGGTTCG
CAATCACTCACGATAACACATAGATCTAATTCGTTCACGCATGGTGATTGCATCTACAAGTGATTCTAGATCCCTAGGACAAGCATTTAATATATCTTATTCATGACCTTTACTCTCTAT
CCATCTTAATCTAGATTGCTTAGTTCTTTTATTAGCATAATCATATCCTATTCAAAGAGCTTTCGGTTACATCGATTAGTGCTTAGTTAAGCATGCAAATCCCTTATTTCGTGGATTGAT
AAACCCGTGGGGAATCTAAGTAAAAAGCTACAACTGATCCATATGCTTGCGGTTCATAAATTGGCACGCTAACTGCCGTCAACAGCCGGGCAGAGGGGTATTTATTGCCTCAAGCCAAGA
AACTAGCCGTTGCTACAATAGTCACAAATACAGTGATCACCGACTTATACTATGACCCCTCATAGCCATCACCGTATCAATCGGTGATCACCGATTCATACTATGATATTACAACTATGA
TCACCTTATCATTTGGTGTATGCATAAAAACTTCCAGAGCTGAATTTAAGCTGATACCGAGCCGAGCCGATCACACTGATTAATACTATGATTGCGACTGCGATCACCGACTTATACTTT
GGTATTGCGATTGTGATCACGCATCATCCAATGATGCATGTTGACTTCAAACCAAGCCAATCACCGATTCATACTATGCTCCTTTCATGACCATCACCGTATCATCCTATGGTCACCGAC
TTATACTCTGATATTGCGACTGTGATCACCGATTAATACTCTGATATTGTGACTGTGATCACCGATTGATCACCATTTTGCTTCATTTTTTCATGTGTCTTTATCCCGGCTTCTCTTTTA
TGATATATTGGGTTGCTTTATGGTCTTTTAGGGTCTTGTACATGTCCTCTTGACCTTTGTTTTGATGTGTTTGATCACCCAAGTCTATTACCTTACATCCATGTGACTAAACCTTGTATA
CTTGCAAACATTGTTAGTCCCATAGGTTAGTGTTGACACACAATCACCAAAATCACTAATGGCCTAGCTAGGACCATTTTCCTTACAAAGTCAAATTTTATCTTTTGTCTGATGCTGTAG
AAACTTGAAAGGAACTTTTTTTTTTGGAACTGGCAGGAGCACTGCTATTCATTGGAGAGTAGAAAAATTTCAGAGTACATATTGTTCGATATTACATAAATGATTAACACTCTTAGCACT
AACATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTAAATCACGAACCCAACATTGGGTTACCACACGCGCTCCTCCTCAACTTGAAAGGAACTTAAAGGTAGGTAACCAACTACAACAT
ATTCTAGACTGCAACATGGTACGGAGCACGATACCAACTATGGGGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNCGTACGAAACAAACAGGCACTATATGTTCCATCCATGTATATTAGTGCAACGCCCAACTAGGTTGGTGAGACGGATCATTTACTCTTGCGTTGCGTTCAGACGTGTGCTCCATT
CCAAGCAAAGCAGAAAGTGAAGCACAGGATGTGAACAACTTCTGCTGGAGAACGTAAGGACGATGCTGCACGGACATGGCGGATTTGAGATGATGGTCAGTATCGTCACACTGGTGTGAG
ATGGAGAGAACCAAATGAGCCTTAGCTATTGAGGTTGATTTTTGTTGGTATTTCTTCTTCTCACTTGGGCCCAAGAATTGCAGCAGGCGGGCCAACGTAATTGGGTGCTGAATCCTGAAG
ATAGGATAAAGTGGGACAGCAAAACCCCAAAATTCAAAGGAATACACTGCTGCTGCGGAGTATTGCAGTAGCTAGCCTTTGCATAAAGGCAACCGTACAGTACTCAAATTTCTTTTGCTC
GATCGGTCTCTGCGTCCGTGGCTGCCACTTCAGACTGGAGGCGGCCTACACTGCGGCTGATTGTGTTCGTTAATCTGGGATTGTTGCCGCGGAGACGTAGCCTGCCTATGTTCCCCGTTC
ACGTACGTTCGTTACATGCGCCGGGCGATCTGCCGATGACGCGGCGCCGAAACGCTCGATCGTGTTGTAGTGGAGGCGCGCGGAGGTGGAAGCGGATGGTGATTGGCCGCCCGGCTGGTG
AACACCCAACACACACACGGCACCGGTCGCACGCGACAGCGCCATCATCCGAGAGCATCCGGCAGCGACCTGGCGACGACCCCACCCGGCTAAGCTTCCGCGCGCGCGGCACGGTGAGAG
AGAGATTGTTGGAGTATGTGGCGACCAGGTCTCCGCTCCGCTGTTGGCATGTCCGCGTGTCGGCCCTCCACACCACAGGCTTCTTCGATCTACTGCTGCCATCGCTGTCCGAAGCTGCGT
ATTTGCGGTTAGAACTGGCCCGGCCGTGTTTCTGGATGATATTCCCTTGGGCGTTCTCGCGGGCTGAAAGGTCCAAGCGAGGCCTGTCGCTGCTGGTCCCACAGCATCTGACAGGAATAC
TAGGTAAGAACGGCCATTATTCAATTCTTTCTTTGTTCAACCTCGCACACGCGTTAGACTATGGGCTTGTTTGGTGGCCAGCCACAGCTGACCATACCACGCGCGCCTGCATCACAGCCT
GCCGCAGCAAATGCTGGTGACGGTAGCGCGGCGTATTACGCTGTGGCGCCGGTACTGTAGCTGTGGCGTGCTGTGGTTGGCAACCAAGCAGCCCCATCTATATCGCAGCAGAACGCACGC
GCGGGGAAGAACTAGCTCGGCCAATATTCGTTTCCATATGCTTGCAACTAGAGGAACGACGAGGGAGAACCTTCGAAGGTTAAAATCAGGTGCACTCTGAGCTAGTCTTCCATGCATGGT
GTGATTGTTGACTCTGATCGGAAGTTCACGCTTCACACTGATCGATCGAGGTGTTAGAGCGTTCCACACGGTACGGCCGGGCAGATTTGGAATGCTACTGTTAAGACAATAAGACGCCTG
AAAGATGCTGGATCTAGATCGGACGATGGATTCCTTTTCTTCTTTTTGAGGTAGGCATTCTCCGGTTCTTCTTCTCAGACGCAAGTCAGGGAATTTAGCGACACAACAGCACACTCCGCC
GCCGCCGACTTGCCAAGAAATGGCCCCGGCACTGCTACTGGTGGAGACGAAACGTTGTTCACGTACGCTTGTGCAGACCCATCGAAGGATTTGCAATTTTCAATCATCTATAGGAGCTGT
GAAGATGTAAAGAGTAAGTATATATCCGCACTCGGACCTGCTGATGTAAGGAAAAGAATCTGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNTAGGTCTACTCAAATCTGGACGCTGACGGTGGTAGCGTATATCAACGCTCTCATCCACTAGCTACGCTCACGCTCTGCATCATGCTGTTAAACCTTGTCCTAT
TTGTCGGATCGTGCTCGCCGAACTGTATTGCTGCCAGTTAAATCAGTCGTCGTCGCCTCGTGGTTCAACGACTTCGAAAGATCTACGCTCAGATCCTCGGTCGTGCCTTCGGAGGAGTGG
CAGCGCACAGGTACGTTTTGCTTGTCCGGTGAGGCGGTGACAAACTCACAAACACAACGTCGTTGGCTCGGCTCGCGGAGACAACGCCTCGTCCTCGGATCCGGTCATTTTCTGCGTCCA
TATCAGTTGGAGTTGTCCGTTGTCCAAGTAGTTTTACTTGGAAAACTTACTTGTTTGCTGCCACGAACATTCTTACGATCGACGTGCGTATGGTGGCCTCTCGTCTAGGGTTATCTCTCC
TTAGCCTTTTTGCCGTCCGTCAGGCGTCGCCTCCTCTCCCGCCGCGTTATACGTGTATATAAACAAAGCCGCGAGCGTAGCTTGCTCGTTCACAGCAACCTAGGCTCTTGGCCGTTGCAT
ATACTTGCATTGCATCACCGATCACTGCAGTAGCAGCTACTAGCGGCACGTAAATCGGGACGCCATGTCGAAGCCGGTAAAGTTCCTCACCACGGCCGGGACTCGCTCCGCTTGCATTTA
TGCCAGCAGCTCCTTCCGTTTTGCTCTTGCTTTATTGCTTTCGCGATCCCCTGTATATGAGAGCGCGTGCCCTGCTGGAAACTTACGCGAGCTAGGGTTCTTCTTCTTCGTTGTTGTTGC
AGCAAAAGATCGTGATCAAGCTGGGCATGCCGAGCCCCAAGAACCGGACGAAAGCCATGGTGCTGGCGGCCAAAGTATACGGTACGCGTCCATCGCACGCAAAAGCAGACAAGCTAGATC
AAATTAATGCGTGCGTGATCGATGTATCTATATATGCAGGGGTGAGCTCGGTGGCGATCACCGGCGACGACAAGGACCAGCTGGAGGTCGTCGGCGTCGACGTCGACACCGCCTGCCTGG
TCAGCTGCCTGCGCAAGAAGGTCCTTCGCCGCGCCGACATCATGGTGGTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTGGAAGAGCTGCTGCAGAGGGGGTGGC
CCGGCTACTACCACCCTCAGCACCACTACCCGCCGTTGATGGTCGCCTGCGAGGAGCCAGTAACCGGTTGCTCCATCATGTAGAAGTAAAAACTANNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCATACGCAGACATATAACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGAGAGTA
TTCATGATCGATTTTGTCGCAGAGACGTATCGTGTGAGCTCTAAACAATGCATGAGAGATATTCGTGCAGTGCATCCCTGCCGAGATGGCGAGATACCTTTTTCTCTCGGATATAGTGTC
ACTACTAGAGAAATGGCCTTTCGTCCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTTGGTNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAGCAGGAATGCAGCACAGTGCCATTTGAGGCGATACAGCA
AGATGCACCGTACTGACATTACCAGACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAGAGCTAAC
GAGGGAATTTCNNNNNNNNNNNNNNNNNNNNNCCACTTTAGTACCGGTTTTTCCTTTAGTACCAAACTAGCAATACCGGTTGCGAAACCAGTATTAAAGGGAAGTTCCTAACCGGTACAG
AAGGTCCTTTCCCTAGTAGTGTGTATTGGAAGTTTTGTATCCATGCATATATAGAAAGTGCATATGGACACGCGCATGTATAGACTATGGAGCATGTAATGTACGGAGTATGTAATGTAC
GTATACAATTGCACACTTCTTTGAGAGTTAACGTGGAGTTCATTTTCTAGCACTCAAATAGTTAACGTGTGGGTACATACCTATGAAACGATTGTCGTGTAATAATGCACATTTTCTCGT
AGATTGTCTCCTACGATACTATACAATATACAATATCTTTTATGATGCGGATGACAGAAAGATGAAGATAACAAGTGTGGAAAAGAAGACAACATAGTTAATAAACAATTCCACTGCTCC
CATCATAACCCATAATATCCATCAATTAATTATATATTACTCACCACTGTCTCATAAAAAATTACTCGTATACATCGTAATTTTACTAATGCAGGTTTTTGTTCCACATTGCAAAAGTTA
AGAAATAAAGTTGCAATCCTCATCATCATTACCATAAAAAAATCTAAAATACCACTATATTTTTGTTTATGCAGCCTTTTTACCATTCTACATAAAGGGGTATCAATTTGGTATCTAACT
ACTTCTAAAATTGATAACCCCTTAGTTAGAAATTGGAGTACATTTCATTACTATTCGAAGGACCAAAACACCAAAAAAAATCAACCAGTAAAGAAAGACCGCCCTATAGCGTTACAACTA
AGAAGAAATCTCAGCCAAACCAGCCGAGAAAACCTCTGAACCCTGGCTTCACCCTATAGTGCCGCGCCATAACTTAAGCCGACCACGACCCACTGGGTTGGGGACTAGTACAACTACCCT
CAGCAAGAGGGGCCAAACAAACCACAAATGGCACAGAAAGGCATCGTGCCACTATTTTATGTGGGGTTGCCAGCGATGAGATTTTTTGGTGCCACCAAGATTTGAATCCGGGGTAGTGTC
TCCTTCACTTGGAAAGGTTATCATTACACAACAAAGATGTAGAGAAGTAGANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNGTACAGGATGAAGCCGCCGTTGTCGTTGCCGGGTGCGTCGCCGGCAGGAGGAGCTTGGGGTGTGCCGCCAGAGGAGCTGCCGGTGCCAGGTGGTAGCACAGAGGCCCCGCTG
TCGGCAGCAAGGGACGAGACAGGAGGCGGCACAGTTGCAGCAGAAGGAACTGTGGTGTCGCCGAACACAGAGGAGTCGGCGAAGGAGAGGGTGGCCATGGCGCACGACAGGGAGGGGGCA
CGCCGGACAGGGAGGTGCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCTAAGAGT
ATTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATATATCCAATGGTACTGAATAAAAAAAAGATAAAATGGAAATCACTACTAGGGCTAATTTTCTAATAACAAGGTG
AAGGAAAAATTGATAACGAAAGGCAAGGCGGTATTACTGGCACATGCACACTTGGATTCTTAATATCTTGCCGCATTAAACACGGGCCACTCGGCTATTTTCTCATGACATCTGTCGTAT
TTCGTAGCTCTTACATCTGCCGCGGACTGCTCATATCTATCAGTTCAGTCAAGAACCTGCATGTGAGTTGTTCAGATGTTTCTCTGCTGTACCTTTGAAATTTTGACCCGTAAAGTGAAA
TACTACATTTCTCTGAGATGCCTATTGCGCATAAAGTGAACACCCCACTTTGTAGTTGTTCTATATTCTGACAGTGGGATCGAAGACGTGTATACAGGGTGAAAACTCAACAATTGGCAG
CACATGGTCGTAAAAGTTCAGAGCCATGTGCCCTTTTAAGGTTCCAATTGTGACCAAGTCACCATTATATTTACTTAGAGATAGAAAACGAATCAACAAGACTGATGACTAGCCGAACCA
ATGGAATTTAACGTACGCGTTGTGAGGTCTTTGGACAAACAAGCTTACACTTAGCCTTCTATGTTCAGATTGGGTAGCTTCTGAAGGTGTATACTTTTTCAGACGCTTCAGACCTAACTG
AAATAAAAGCTGAGAACTAATGGAGCACTTAGTAGTTACTAGTTAGTATTGTGAAATTTTAAGGTGTTTGGTTTGTGGAATTGGATGATTTTGTCGTCTATTTTTGTTTATTTTGGAATG
AGTTGATCTGTTACCTCCTCATTCATTCAATTCCTCGCAAGTACATAAGTAGTATAAATATTAGTCTCACAAAAAATTCATAAGATCAGCCCATGATGGGCCACACCATCTAAGACGACC
TAATTACTGAAACCAAATATCCCATTTTCCCATTAGTCTGTCAGGGGACAGTGCGTCTCACCACACGATCAACATGTGTGGAATGGAGGTGAATTCGTTTCTCCCTTCTCTCCGAGTTCC
AAATTGATTTTTTTTCCTACCTGATGAGCTGGATTATTTCTGTTGAGAAAGGGAGTGTTACATGACTCTGAGAAATAATACTCAAACCATCTCTAAANNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTGAAACGGA
GGGAGTATATATTAGAGTTGGAGTTCCTCTACTAGTCAGACAACCGACTTTCACGAAACATATCAAAATTGAAACAAAAAGCATGTAAATGTTGCGCGCACTAGCTATAGCACTTTGACT
GTGTCAATTCTTGCATCTGTTCTGGTGAAAAGGTAGACACGGCTTAAGAAAGCGTGGAATGAAGGGGAGCTTTGCAAAGCAAGGTCTTAAAACTATATTCTTCTTCTTTACCCACGGCAT
GGATGCATTGGTAGTTTGGCTGGGTCTAAACCGCATGAGATCTTCTTCTTAGCTCAAAGTATAATCGGGGCATAAAGCACAATTCTCGGGGCTATACCCACTTGTTATACTAGTCTATTT
ATTACTTATATAAGCCGCATAAGGGGCTCTCCTTCCGTCCCCAACAACACTCGGAGCTTCAAGTGTCAATTCCGAGCTGTAGGATTAGTAAGGAACTCTCACGTTGGACCGACCGAAATC
AGCAACAGAGCAACAAAATGAAGGTAACACGAATTCTCATCCAAACGCGAAGCACCTGAGTCTGTTGTTGTCTACTGTCTAGTGTCTACTTTGTCACTGTCTGCAACGGAAACACCTGAG
TTTGCATTTCCTTTTTGTTTGCTAGCAAAGGGTCGTGATCCAGGTGCAGATGAGCGGTGACAAGAGCCGGTCTAAAGCTCTGGGTTTAGTCGCCTCCACGCACGGTAAGCATCATTTTCT
TACACTGTCGGATCACGCTAGCTCTCGAGCATGAGGTGGCTGTCTGGCAGAGCTAACCGTACCGGCCGGTTTCGCCGTCGTGTTCGCAGGGGTGCAGTCCGTGGCGATAGAAGGGAGGGA
GAGGAACCATCTGGTGGTGGTCGGCGACGGCCTGGACGCCGTCAGCCTGACGAGCTACCTTCGCAAGAAGGTGGGCAGCGCGCAGATCGTCCAGGTGGAGGTCCTCGGAGCCGGCGCCGC
CGCCGAGAAGACGAAGCCGCCGGCGACGACCACCACCAGCGTGCTAGCCGCGGGCTCGCAGCAGTGGCAGCCGCGCTACTACAGCGGCTACTACTCCCGGCCGGCCGCCGTGCACCCGTA
CGCCGGCCAGTACGGCTACGGCTACGACGACCCCCGCCCCGATGCGGACTCGTCGTGCGCCATCATGTGATCCGCAGGCGAGAGGCGACGCAGCCGATCGAGAGGAGCGTTGGATGATCC
ATCCTCCGAATCTCCGATACATAAACGAAGAGAAAAAAAAATGGCTGATGGTTGCAATCGTAGATGTAGTATATTTGTGTAGGAGTTCATGCGCTGTTAAATTTGATTGGTTTATTTACT
TGTGTGGCATGATTTCGCCAATGTTACTGTAAGAATGAATGAGGCCAATTGAGCTCTACATGACCTTTTAATTTTCCTTGTCTTGGCTTATAGCCAGTGGCGGACCGAGAGGACTAATAA
CAGAGCCTGGGCGAAATGCAAGACCTCTCTTCCTTCACATCTTCGGCAGAACACAATGATACAAGATTTGACAGCTCAGCTCTTGCGACCATAGCGCATGAGCCCGGGCAGGTGCCCAGG
GTCGCCGGGCCCTGGGTCCGCCCTGGCTATATAGCTGCTATACTTTTTTTCAATGATCATATATTCCTTAGAGGGGATTGGAACCGGCCAGGAGAAATAAAGTACTTGATCGTGAGCGAT
CCTGCTGCACTCGATCATGAAAGTACCCGATCGAGTATGAAGATCCCAACCCACCAAAGTACGCTATCTGAACTCTCGTCAGAAAACTGAGCTCTTGAAAGGCCCAACGAATTAAAATGA
CCCCATTACGCCTACGTGCGGCGCTCGCGAGATGATGATTTTCTCTCCTGATCACGCGATCCCCGGGGTACGGTGCCGGGCGCGAGCAGGGGCGGACGACGGCGACGGCAGCATGCGCAA
GGTCCTCGAGCGGTCGTGCGGTGGTGGAAGGCAGGAACTGGGTGGCGCACGGCACCGGGACGGGTGGGACGGACGCGACGGCGGCAATACGCGACACGCTAGAGACTAGAGGCCGATTGG
CGCGATGCGCGGTCGACTTGGCGAGACCCGGCTGGGGAGATCAGCGAGTTACGGCGACAGCGCTAATAAGCTGATGATGGAGAGGCAGCGGAGCTGGGCTCTTCCCGTCCAATGTTACTT
GTTCTGACCTGGTACCGGCAGTGTTCCTTAAAACTCTTTCGCCCTTCGGTATTGTGAAGAAGGCATTTATGTGAGGAAAGGCAGTTGCTTCGCTGCCACGGTTGCTGCAAAAAACAAGAA
CCCTAGGTATCCTTAACTACGGTTTCGCCTACGTAGCGCTGCATGTGTACCGTGACATCATGAGTCTTTTTTTGTTTCTTGAAAATTCTAAGGCTCCTTATTGCTGTCTGCAGAGATATT
ATCGAATCCGCAAACGTTGCCCATCAACCCAGGCTGTCAAATGACGACTGCGGGAGACCTAGGAACACCACCGCGATCGCGTCTTCGCTGAAAGTGGCAACCCACATCATCAGTCTCCAG
TGGACGGCCGCATTGTCCCGGCTCCAACACATCTCCATCGTCCAGTGCCTGGTCCCCGTTTTTTCTATGGCTAATCAGTAATCACTCGCTCGGGGTCGCTACCTAGCTTGACGCAGCAGA
CGTTCAACTGCGCACGATCGAGCTTATTATCAGCTTCCACACGCTACGTACGTAGGTTCTCGGCAATCTCCCTGGCCGGATTCCTAGAAAGATAAGAACAAGACCTCTGTCCCCGGGCCC
CGGCCCGTCCGTCGCTGTAGCCTTCCGCGGGGTCCTCTCCACCCTCTTGCCCCCGCGCGCGCGTGTATATTTATACACCAGCCATGAGCGCGGCTGCTAGCTCCTTCACAAGCTACTCGA
TCAGCTTAGCAGGGGCAACTGGGAACACCCAGTCAGAATTATAAGCCTGACAGGGCAGGCTCACTTGTTTCCTCGGCGGAAGCGTACGTGGATCTATCAACGATGTCAAAGGTAGTGAAG
CGTGGATCTATTTTCATTTCTGCTCCTGCCGTTTTGTTCTTAATTGGTCTCGCAATGCTTGCTTGAGCATTCTGCGCGCGAACTGATGATGGGCTGGGCTCTTCTTTTTTTTTTATTTGT
TGTTGCAGCAAAAGATTGTGATCAAGGCGACCATGTCCAACGCCAAGAGCCGTGCCCAGGCCATGGTGCTGGCCTCCAAAGCAAACGGTACATATGCTCCATACATTANNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGTCCATTTGTGCATGAATGANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNTGTTGAATGAATTTTTGCAACTGCAACGTGCGTCTATATATATGCAGGGGTGGGATCGGTAGGGATCACCGGCGACCTCAAGGACCAGCTGGAGGTGGTCGGCGTGGG
CATCGACATCGCCTGCCTGGTCAGGTGCCTGCGCAAGAAGCTCCGCTACGCCGAGATCGTCAAGGTGGAGGAGGTGAAGGACAAGCCCGAGGAGGAGAAGAAGAAGCCCGACCCCGCCTG
CACCTGCACGGGGCCGTGCCGGTGCGCTGCCGCCGGTTACTACCACGCGCCGCTGCCGCTGTATCTCTGCGAGCAGGACCCGCCGCCAGGCAGCTGCCTCATCTTGTGAACCTAGCAGCA
GTAAGATGGGCTCCGTCATGCATGCATCTGTGTGATTTGGGTTCTATAAGAACCTTTTGAGGCAACAGCTTCTTCGTGTGTGCAGTGTGCTGTGTGCATGTGCGCAATCGTGGTTCTGGT
TTGCTTTTGCTACCGCCAACCATCGGTAGTGTCATTAGATCACACCACTACAAGGTATTAATATCATATAAACCCCAATATGTGTGTATGTTATACGTGTAAATATATGTATATGTGTTA
TCTGTACGAGTATGACTTAGTTGCATTGGTTTATGCATCCCATTGTGAACCTTATGCTGAGGTCGTATTTTTTTCCTATTACTATCAAAGAAAAGACATGAGTACTAATTAACGCCGTAT
GTGAAAACGTATAAAACTCACAATATGCCAACAGGTACCTAGTGTTTTTATGCTAACATATATGATATATCATAAAAAAAATGTCGACTGGCGGAAAATACTGTTCTACGACATTGCACT
AAGAAGAAATATTAGCTAAGCCGACCGAGAAAATCCATGAACCCCGACTTCACCCTATAGGATCACATTGTAACCTAACCTGACCACAACCAATTGGGTTGATGATTAATGCAAGGATTT
GAACTCTGATTGGTTTTGATCTCCCTTAACTAGGGAGCTTACCACTAAGTGTTGGCATATGATGTATCATGATACACCTATGGATTTTAATTTCCGTGGATCTCCACTGGTATTTCAAAA
AATATATAGGGACAAAAATAATACATATGGTGAAAATTTTCTTTCTTTAGATTTTTAACTTTAAAACGAGTAAATTATTAAGTTGAAAGCCCAAAAGTCGTCGTAATATCGTTCTCAATG
GCAAACAAATCTCCCACGTGTACAAAATCCCACCCTTCCTCCTTTTTCGTTGACAGTTTTCTAAGACTGGCATGTGGGGCTGACATAAAATGGGTGGGAATAAAGTTTCAAAAAAAAAAT
GGGTGGGAATAAAATAATGCAACCTTGAGATTGGATTCAAGGCCTGCAGATATCGATTTATTTGCAAGTCAGTCGATATGTGCAAATAAAATAATACTTGGCATCTTTATTTGTGATTTC
AATCAGTTTTCACTTGACACCGACCTGAACCTCAATTTCTCAAGTGTTTGCTTATAGGTGTAAGTTTGCATGTGCACATGTGATTTGCGATTGCATGAGCCAACCTGTGACGGTAATGTA
ATAATCAGGCCGCAGTCAGCAGGTCCTGTAGCAATGTAGCATCAAGAACGGGTAGGGTAAACTGAACTGCGAACGTCATCTACTGATCTACCAAGAACAAATTAACATCACGCCAAAATC
GTAGTGTCTGTTCGCACCCTGATCGAGATGCATGGATCATGATGAGTGAATGATTTGCATTTTTGCCGTCTAATATAATGCCCGGTAAAAGCATTTTGAACTGATGATGATGGTGATTGG
AAAGCCACGCTGATCAATAATGCAGTGGCCTGGTTCCGCACATGACTGAATTTGGTGAATCAAGCTGCCAATCATATGCCACAAATAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTAAGTGGCCAATCATATTCCAGTTTATACGGATACATAACTGCATTTCC
TTCCCTCAGAATCCCCGAACAATGATTAGAAAATGACCTCCGACCTTATTTATCTCTTGCGCGTGCATATTTGCATTTTTATCACTAATTGCTAATGCAAGGTACTACTCTTTAATGCAT
GATTTTTATTTTCACTTTGAGACTACTTTTCTTACAATATTCCATCCTTTAAAAGATTTTTGAACGTCTTTAATTATTTTGAGCAAAACCTACAATTTGAAGTGAAGGGTATATATATCA
GTTCCGAGTCAAATCTATAAAATTTGTCTCTCTGGCGCCGGCGCCAGCGCCTATCGCCATTTGCCGGCCGAACACATGGTCAAGGATCTAGTTCGTGAGATATACATAAAGTGAAGGTGG
GCAGAGGGCGGTGACAAGAGTGATCGAGGCACAGTGTGGAAGCCAAAAAAAATAGATCGAAACCTGTACGCTCATCCAATCGCCATCACATCCACTTAGATATAGAATAGACCAATCAAG
AGAAATCTCTAGGCAAGTAATAAGGCATGTGGAATTCAATGTATGCGTTGCAAACTTGCAGTCTCTTCAGCCATTAGTTCACTAGCTGCCACCTGCGTCACCTAAGCTTTTCGACGAGTC
CTCCACCCTCTCTTACCCATAGTTATTTGAACCGGATCGGACCGACAGTTGGACACCAAAGCCTATATCGGCTCGGTTCACTTAAAAGATCGGCCGTGCAATCGAACCGTTAAAAACTGT
CGAACTGGCCGATTTTTTACGGAACCGGTAAACTGGCTGGTTCCGATTGAACCGGACTGGTTTTGATTTTTACCGATGCGAACCCTCCTCCATCGATTCAGTTCAATCTTACCGGCCTAG
GCGTATAAACGGAAAGACTTTTCTTTCTTACGAGCAACACTTGTTTGGCTTTGCATCTGGCACAAATGGCGGCCGCGGCGGCGCATCTGCTGCCTGTTCTTCTCCGGAGGCGGCCGCTCC
ATGCCTCCACCTCGCCAGATCGAGCTCGTCCCGTGCTCATCTTTGCCGGTGGCAGCCCCTCGACGGCGGCCCCTCATCTCCTTGCGGCTCAACGGCTTCACCACAATGANNNNNNNNNNN
NNNNNNNNNNAACGCTGCGCTCTAGTGCTCCGTGCCTCCAGTAGTCTAGTCCTCCACTAGCTCGTCCTCGTCGTCATCCTATCCGGCTTCTCCCTGCTCGGCGCTCGACAAGACCACAAG
GAATCTGCTGCCCGCGATTCTCCCTGCCTACCTGACATGGCTATCGGTTGGTAACTCAGCACCCAAGGTTCCAGATTACAATGATTCAAGTTGTGCAATGATTAGAGTTCAGACTTGACG
AATCTAGAGTCGAAATTGTTTGCAACTCAATAGGCTATTGAGTAGTATACTGAATGGATAGAGCACACTTGCAGTACCACTACGTGAGAGCTCAATTGTCGATAGGCTATTATTCAGTGA
ATACGTGCAATTTCCAGTAGATGGGCTAGTCCTAATAATTTAATAAATTGTTATTTGAATTAGTGGTTCGTATGCTGAACACTTGAACTTGGAATGCAACTACTATAGTTATATATTGTG
TCATTTATGAGGATATTTTTTCTATGATCAACTATATACTATAATATGTACAGTTCATCATCAATGGTATATTGGACCGGTTCACATTATTTGTGGCTGGTTCACTTCAACGGTCCAAAG
TTATTGACCGGCGGTTCAACGGTTCCTAACGGTTGAACTAATAAACCATTGAACCGACACCCTCACCAGTTCGATTACTGGTCTGATCCTAATAACTATACTTGCACGGCGCGGGCGTGT
ACTCGTATTTATACACCACGAGCGCGCCTGGTAGCTCCTTCACAAGCTGCACGGAGCTTGTGTTCTTTGGCTCTCTAAACGTCGATCTGTGTAGTAGAGCCACACCCAGTCAGAACAATA
AGCTAAGGCTGACAGCCTCAGTTACCTTGCTCAGCTATCTTCTCAGTGTAGTTCGTGATCGGATCAACGATGATGAAGGTAATAGTGAAGCCACCCAGTAGCAGTTCGCTTCTGCTCCTC
CCGTTTCGTTCCTCATGTCGCTTTTATTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCTCCGATTAGC
AATAGTAAGATTTGTCCGGCGAACTGATGATGGGCTGGGCTGGGCTCGTTGGTTGTTGCAGCAAAAAATTCTAGATCCAGGTGACCATGCCCAACCCCTGCAGCCGCTCCCGGGCCATGG
AGGTTGCAGCCAAAGCAAACGGTATAGTACAATGCACCCCTCGTCATACGCAAAAGTACGCAGATTTATGCACGAATAAGTCAGACAAACAATATCTGTATGCGTCTACATATGCAGGGG
TATGCTCAATAGGATTATAGGAATCACCGGCGACTTCAAGGACCGGCTGGTGGTGGTCGGAGAAGGCATCGATATCGCCTGCCTGGTGCAGTGCCTGCGCAAGAAGCTCTGCTGCCATGC
CGTGACGATCCTGCTGGTGGAGGGAAGTGAAAGACAAGAAGCCCGAGGAGAAGAAGAAGGCGGAAGAGCTCAAGCTTTGCGCGTGCCCAGCGCTGTGTTGGCGCGCCGGTTACTACTGCC
CCANNNNNNNNNNNNNNNNNNNNNNNNGTCGGATGTGTTCTGCTGCGAGGAGACGCCGGCAAACGATTGCCACATCATGTGAAGCTAGTAAGATGGGCTCTGTCGTGCATGCAGCTGTGT
GATTTGGCGGGTTCTGACCTTATGCCACGCCTATCGGCTTCTTCGTCCGTGGAGTGTGGTGTGGGCATGTGCACAAACGGGGTTCTAGCTATACGGTTTGGTTCCTCTTCTGTCGTCAAC
CGTCGGAGGTGCTCGTATAAGATCATTACAAGCTATTATCATAAAATGTAACATGTATACGTACATTATACATGTGCAGTAATATGTTTATGTGTTATGTGTATGCGTCTATGAGTTGCA
TTGTCATTATGCATCCAGTTCGTGAACCTGATGCTGAGGTCGTATTTTCCCTGTTATCAAAGAAAAAAACATGCGTACTATTAGTGTCGTCTGTAAAAACGAATTAAAGTTATCCCAAAA
AAAAGAGGAAACCAATAAAAGTCACCATCTCTAATAGACGAATTTTGGTCAGGCAATCGGGCCTTTCTCGAGCGCTCATCGTGCCACGTCGACTACTCATCCGCATCGTCGATTAACTAT
TTTTATTTAATCGCACGGTCAGAATAGGCCCCGTCAGTTAGCAATAGCATTGTCCAGAGCCTTCCTCAGAGTTCCCCATCCCTCTGGTCTAGAGCGGCGATGGCAAGCCGCGCTGACGCT
TGTACATACACCAGACACCTACGGTTGTACATATACCAGACACCATTTATTTCAATCCAAACCAGCAGACCAAATCCCCATGACCCCATCCAAACCCCACAAGCTAGACACACAGTGGAA
CATCCAATTAACAGGAGCACGTCTACAACCGATCAAAAAGAAATAGACGCAAGCAAAGAGACACCGTCGCAAGCAAGTTTGGCAGGACCTTTGCTTTGTTACTAGAATTGCGGTCGATTT
ACCTTAATCTTTCTTTCCCTTTATCTATACTAAAATCGACTGGATCTCAAGTACGGGGCTGCCTGCTAATACATACTGAATTGCGGCCTGCTGGCTGTACGTCGCCGTCTATATATACCG
TACGTGCACCTAGCGGAGGTAGCTCCGTCGCAAGGCAGCTGCCGATCGCACCTGCAGAGGAGCATCGACCGAGACCGGCGCAGAAATCGACACGTTCACCAGTCTCTACTGATCGCAGTT
CTTCTTTCCCTCATCTCTTCTATCTCCTCGGCGGCGCGTAATTAAACCACCGCCACCAACAACGCCATGAAGGTAACTTTGCTTCTTCCTATTCCCTTCATCATATCTTTGCTGTGTCCC
CCTAGCTCTTTTGCTCGCGCTCTGCTAAGCTAAAGGGACCCTGTTGAACGCAGCAAAAGATCGTGATCAAGCTGAGCGTGGCGAGCGACAAGAGCCGGTCCAAGGCCATGGTGCTGGCCG
CCAAGGCAGACGGTACGCAACGCACGCGTTGTTCATGTTTGTTCTCTCTTCCCGTAGATTAGCCCTGGGCCATCCGGCCATGGCTGCCAGTGCTGACTGCGCCCGGTGTGTACGCGCGTG
GTTGCAGGGGTGAGCAAGATGGGGATCACCGGCGACGGCAAGGACCGGCTGGAGGTGGAGGGCGACGGCGTCGACGCCGTCTGCCTGGTCGAGTGCCTGCGCAGGAAGGTCGGCCACGCC
GAGATCCTGCAGGTGGAGGAGGTGAAGCCCGCCGAGAAGAAACCGGAGGAGAAGAAGCCGGATGAACCCAAGGTCGTGCCGCTGCCGTACTGGTGGTATCCCTACCACTACCACCACCCG
CAGCCATGGTGTTGACTGTTGAGTGGTGCTTGCTGACCAGCCAGCCGATCATGGAACCGGCCGTTTTGATGGATGATTAATACTCCGTTTGAGACTCTTTGGTATTTGTATTCAGACTCT
TTGGTATCGAATGAAAATATGAAAACCAAAAAGAATTAGCAATGGTGTTACCTGTCCATATATTTAATTTGATCGGTTAATTTTCACCCTTATGGTGGACGGCTATACTTTGGTGCTATG
GTTTCTCTTTTTTTTTTTCCTCTCAAATTTTTCGGACCCTGAGATTCTGGCAGATTACCTAAAGAAAATTCTTACCTGTCCGTATTCTAGGTAAATATACTTAAATGTGAAAAACACACA
CATTTGGTGCCTGACTCCACTCACCAGATATTCAACCTTGGTAAATACATTTAACAAAATGGTAAAAATTTCTATGTTCATCCTTGGTTGATGCACAAGCCGAAGATTACCTCAATTACA
TAGTTAATAGAAATCAATTCAATTTTTTTACAGATATCTAAGTTTTTCCGCGTTCCGATATAATCCCAATGGGAATTAAGTCTTAAGCATTTGGATAAGAACAGTATGGTGGACCAAGGA
TGAATTTTCAGCGACGAAACGTTGAATAAAGAGCGAAATCCGAATATCTAATTGGCTGTCCTGTTACAGTCTGTGCGAAACAAGAATTGTCAAGTGGTCCCTTGATCACTATTGGTCTTT
AGAACCAGTTAAGTATTCGTCAGTCGTCACCGAGTTTTTCTGACGTTCTGAGTCTGAAGCAAGTAAGGGTAGGTGACAGCAAGAAGACTCAGAGAGAGGTCCACGCTCCACAAATAAACT
GGTGGCATTTCACCGTCACAGAAGAATGCAGTGCTCCATAAGCAAACGAAACAGGGTCGTAATAAACCATCGAAAACGCAACGCGTCTGCATCATCTTTCTGTATGTTTGTCATGTACCT
GAGATATGATCAGGTAGGCCTTGATGATTACTACTTCTAAGCGGTCATTTTCAGAGTGAGACCGATCGTTGACTCGTGCGTTCACATCGATCCCAATTTTAAAACTGCGTCATTCGCATC
TTCGGGGTCGGTATAACTCTGCGTATAGTAGATGCAGAACACCAGTACTGTTATCATCTTTTCCAGAAACCCGTTGGTACCGACAAAGGGAGGCACCTCATGAGCAAACTACCTGCAAAA
GTATCTGGGCAGTGCCACTGCCCAAGTAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCAAAAGTAACCAAACG
AGCTTTAATTCGACCCTAACCTGCAGACTGCTACTGAAAAGTGGATTCTGAGATCCGGCCAGTAGAGTATCCCTCCTACTGGCGTGAACCCGCAACACTTCCCGTCTGGCAGGACTGGCA
TTACACCGCCGCCCGCTTGCTGATCCAACGACACGCAATCAGCATTACACCGGTAAGTGCTTGTGTATTCGACTGCTCTACTGGTATTAGAAATTTGGAACATGCGTGCATGTGCTCTTG
CTGTCGGCAGACCGACTCAGTCAGAGGTATATTTGTCGACGAAGGGCGCAGGCAGGCAGCGTGGGCAGGCCAGTGTGGCTTACGAGATTTGCTCTCGGCCTGATCAGATCCCGTCGAGTC
AAGCAAGTCTGAGAACGCGATTAGTCTGATGCTTTTGCTCGATTAAGTAACTGCTCTGCTGACGCGGAGCTTGATTATCCCTGTACTAGACTACTGCCACTCCGCCAGTAGCTAGTGCCA
TTTCCGTGTCCGCCTCTCCTCCACCGTAACCGTATATAAGACTGGGAGCGGGCTCAGCCACCGTATAATAAGAGTATGCATTGGCATCGGTCGCCGCGGCCTGCAAGAGAGATCGGTGGA
TCAGTAACCAAGGCACCCAAGCAGCATTTCTGTCACCGGGCCGGTGTTGCAGGGAGGGAAGCCACCTCCAGGAAATGAAGGTAATTAAGCCTAGCACCGGCCTGCCCGCTCGATGTGTTT
TTCATCGGCCAATCTCAAGCACTTGCACTGATCGCGTTTAATTCTCGCTTCTCCTTCGTCGCCGTCGTTGGGGCAGCAAAAGGTGGTGATCAAGGTGAGCATGCCGTGCGAGAGGAGCCG
ATCCAGAGCCATGGCGCTGGTCGCCAGGGCACACGGTACGCGCGCATTCTAACGTACATTTCTGCTGCCACGTCCTTGCCCTGCTTCCTGCACGCGTGAATCGCATTGGTGCGGTGGTGC
GTGGGCGTAGACTGACAGACAGTGCCGGCACGTACGGCTGCGCGTGTATGTGCAGGGGTGCTCTCCATGGAGATCACCGGCGGCGACGCCAGGGACAAGCTGGAGGTGGTCGGCGACGGC
GTTGACGCGGCCCGCCTCGTCAGCTGCCTGCGCAGGAAGCTCGGCCACGCCGAGATCCTGCTGGTGGAGGAGGTGAAGGACAAGATGGCGGAGGAGCCGGAAGAGCCGACGGTGCAGCAC
GAGGCCGCCGTGGAGCCGCCGCCTCGATGCTACCACAGTTGCCACGACTGCCACCACCACCACCACCCGCCGCCGATGGTCGTCTGCGAGGAGCCCAGCAACTGCCCCATCATGTAAGAT
AGGTTGGGAGCTTGGGGTGAACAAGAAAGATTTTGGTACTAAGCATTCTGTAAAGCAACTGGAGCGAATCAGTCGATATGCGCAAATAAATAAAATTCACAAGTGGCGTCTTCGTTTACG
ATTTCAATCGGTTTTCACTTGGGCATCTGAACCTCGATTGCTCACAAAAGTGTTTGCTTCTTCGTGTAAGTTTGCAAGTGCACATGTGATTTTGGGTTGGGGTCGCATGTGCCAGTGAGG
CAATCAGTGACGATAGTGTAATTAGGTCGCAATCAGCGCGGGTACCGTAGCATCAAGCAGAACGGGTAACGACGTGCAAATTGAACTGCAAACGTCACGTGCCAAGAACAAATCAACGTC
ACGCCAACATCGTACCCTGATCGAGATGGATCATGATGGATGAATGATTTGCATTTTCGCCGTCTAATATAATGCCCGGTAAAAAACATTTGAACTGATGGGGATCGGAAAGGCAAAGCC
ACGCTGGAAAAAAAAATAGCCTCAACATATAATGCAGTGTCCTGGTTCCGCACATGACTGAATTTGGTGAATCAAGTGGCCAATCATATTGCACGAATAAGTAGCCAATCATATTCCAGT
TCATATGGACTCATAACTACACTTCAATTCCTTAGAATCCCCAAACAATAATTAGAGAATTATTACCACCCACCTTATGCGCATAGTACATATATATTTGCATTTTATTGCTAATTTCTC
TAACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTTTTGGAAGGAG
GGGAGTAGTTGGTAATATACAAGTTACTTTACTATTCTTTAGGGCGTTATTTTTTTCAGTTTGAAGATTCTTATATTAAAGAGCTTTGTTATAATGCTTTTAAAGTACTAGGTACTTTCC
TTTCTTATTCTTCTAATAAAAAAAGAATTGAATAGATTTACACATAATTAAAAGGGTATTATAGTAATTTCTCACTATTTTTTCCTTGATCCCACCAAATCGGTACTTTTCTCTTTTATT
TACTTTGTTTTGTTTCCACTGTTTGATTTCGCTGAATGGAAGGCTCTTATTTTTTTCAAGCACTCTAAAAGTTTTCTATATTAAAAAGATTTTTGTATAATATCTTTAATTGTTTTGAGC
AATTTTTGTCAAATTGGTTGGTTCGTATCAATTCTATTGACTGAAACCTATAATATATATGCGTGAGATGTACATAAAGTGAAGGTGGGCCGCCGGGCGTTGATAAGACCAAGAGTGATG
GAAGCTTCTTAGAAAACTCGGCGATTACCACGCTAACACGGTCATTTAAATTCTGAACCTGTGCGACCATCGAATCGCCATAATATCTACTTAGATGGAGAATAAACCAATCAAGACATA
GACAAATCCCTAGTCAAGTAATTTGATTAATATTGCAAGTGGAATTCAATGTATGCGTTGCGATCTCCCATTCCACTGGCTGGCGGCTGCGGGCTGCCATCCTAGGAGATAGGACCCTCT
GCCCCGGCTCCTGCGTCACCCTCTTGCCCCGCTCGCGCGTGGGTATTTATACACCAGCCACGAGCGCGGTTGCTAGCTCGCACCTTCGCAAGCTACACGAAGCTAGTTTGTGTGGCTGTT
GCACCGACCGGCCGGCGGCAAAACGTCCATCAGTGTGGTAGCCATATCCAGTAGTCAGTAGTCCCAGAATAATAAGCCTGACAGGCTCATCAGTGTCTCAGTTCGTAAACAAGTAACCAA
CGATGAAGGTAGTGAAAGCGATCTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTTCGTTTCTATGTTCTCATCTCACGTCGCTTAATTT
ATTTGTCCCCTGATGCTTGAGCATCCCGCGTGAACTGATGATGGACTGGGCTGAGCTCTGGTTGGTTTGTTGCAGGTAAAGATTGTGATCCAGGTGACCATGCCGGACGCCAGGAGCCGC
TCCCGGGCCATGGAGGTGGCCGCCAAAGCAAACGGTATAGTATATTTGCACACCCATCATCATCACATCACACTTCAGAAGTAGGCAGATATATACATCTATAGATTCATTTATGCATGA
TGAGTACAACTCCAACAGCAACCCAGATATGAATGGGTGTATGCAGGGGTGAGCACGATAGAGATCACCGGCGACCTCAAGGACCGGCTGGAGGTGGTCGGAGAAGGCATCGACATCATC
TGCCTCGTCATGTGCTTGCGCAAGAAGCTCTGCCACGCCGAGATCCTGCAGGTGGCGGAAGTGAAGCCCGAGGAGAAGAAGAAGCCGGAGGAGAAGAAGCCTGACGAGCCCAAGCCCTGC
GCGTGCCCGGGGCCGTGCCGGTGCGCCGGCGGTTATTGCTACGCGCCGCTGCCGATGGTTCTTTGCGAGGAGCCGCCGGCGGGCGCTTGCCGCATCATGTGAAGATGCTAGTAAGATGGG
ACTTCATGCATATGCATCAAGAGTAATTTGGGTTCACCAATAGATGTGTAAGAAGAAAGAAAGATGGTTGCATCTGGTGTACGCATGATAACTTGTTTTTGAAGCGAGTACGCATAATAA
CTTGGTTTTGATAAAAAATTAGCTTACTTCTTTTAAACACGTTGTTTTTAGGGGAGTATATTGGTTATGATTTTGATCTCTATTGCAGCGTGAGTAATCAAGAGAAACTATTTGTTCAGC
AATCAAAGCGTTATAGATTGTCACTTGGAATATCTTTGCTAGGAATGGATGGAGAAGTAATAATAGACTTTGCTTTTGATTAATTCCATAAAATTTTCTATTTTTTCATCAGCATTTGAG
TTGAGAATGTTGTAAAACCTTGGCTATGGGCAGGTGGAGGAAGTGGAGGACAAGAAGACCGAGGAGGACAAGAAGACCTTGGCTGACGTACGTAGATAGATCATGATGGATGAATCATTT
GCCTTTTCGCGTCTAAAAGTGGCTTCTTCAAAAGAAAGTGGTAAAGGCTCAATTATGCAGCTGCTACTCCGAATGGCTGAATTTTCTTCTCTGCTGCCAATTGCAGTCCTGTTGGTTTCT
TTGTCCTCATGGGTTGGTGAAATCCAGAAGTAAAACCAACAAGTGGCCACTGACCACAATCAGATTCCAGCTCTACTCTTCCTTCCCCCATAAGCACCCACCAAATTTCTCTTTTTTTTT
ATCAGGATATGTCTGTTGTTTGTTATATAGATTTATATACCATTGCAACGTGCTATTTTTGTGAGCGTGAGATTTTTTTTTCTTTGAAGCTACATCCCAGGTTTTCTTAGAATACTCAAT
TTGACGTTTCAAAAAAAATGAATACTCCATTTGGAAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNAGGAAGAAAGAAAGATTTTGCATCTAGTGTATGCATAATAACTTTTTTTAAGCGAGTACGCATAATAACTTGGTTTTGAGAAAAAATAGTTTAC
CTCTTTTAAACACATTGTTTTTAGGGGAGCATATCGGATCTCTATTGCAGCATGAGTAATCAAGGGAAACTATTTGTTCAGCAAGCAAAGCGTTATAGATTGTCGCTTTGGATATCTTTG
CCAGGAATGGATGGAGAAGCAATAATAGACTTTTGCTTTTGATTAATTCCACAAATTTTTCTATTTTTTCACCAGCGTTTGAATTGAGAATGTTGTAAAACTTTAGCTATGTGTGCTCGC
ATAGGGCAGAAATATTTGTTTTTTCTAAAAAATAATACACCTATAGATTTTAATTTCGAAGCATCATCACTGATGTTTTGGAAATTTTAGACGCAAGAAAAATGATACGTTTTGGATATT
TGAATTCCATAAATCATGTCGGTGGATAAAGTATTCTACAAAATACAAGAAAATCTCACGTAACCTACCATTTACTGATATGATGATATACTACCTTCATTCACAAATACTTGATATGCT
TCGACTAAATCTTGGTCAAAATGTTTAAACTTTGACCATAAATAGTTTTTAAATATTTAGTTTGGAAACACAATAATTATATATGGATTTATCTTGAAAAGTAAGTACTATAATTATATC
GTACTTGTTGGATATTATAACCATGTTTTGAATTAAAAATGATCAAAGTTAAAATTCAAACAGTTAAACTGAGCATAGCTCAACGTGGTAGGCGACGTGCCTGTCTATAGCGATACACCA
ATGGTGACTTTGTCAAGTTCGAGGATCTATACCGGCTTACTCTCTCAGAGATGCTTATAAAGATAGGGTTGTGTGCGTATGTTCATAGGGGGTGAGTGTGCGTGAGTGTTCGTTCTGTAA
TGTGGTTCGAAAAAAATAAAACTCAAACAGTAACCGGGATACAACCATATTTAGGAAGATTTTGTTTAGATAATGGCCTTATTCACCGAGGTACCATCTAATATTTGTTTATAGAATTGG
CTGAGAGGTTTGTTTTTTTTCATCACTCTTTAATGAAATCGATATTCCTTTATGTCCGAGTAAAACCACGCCAAAGTTGGAAAAAGATCAATCATGCAAAGGAAATTAAAGCGCTTAGTG
CATTAATTAAAACCTTATATATGCTGCAAATTTAGTTGATTAGTTCTATGAGAGCAAAAGGCTAGGCCCGTCTAGCTGCACAAATAAGGTACGAAATGGTAATCATTCTTCACTTTGCGT
TAGATTCTTTTCTCAGAAGTTCCCTGTTGTCACCTTTCTCACTTTGCGTTAGATTCTTTTCTCACAAATAAGGAGTATCTGACAAATGGAACCTGTGTTGAACGACGAATGAAGTGCTTG
TAACTGTTTTCACAGAAACGATCCCAGACACAAATTTCCTTCGGAAAATAATGTCATACACAATCAGTGTATACTTAATTTAATATTTCCAGCTATCTTAGTAGCATAATTACAATCACG
TTCTGACGAATCAAGTGTCAAAAAGTTGTAGCCAGAAACTTTTTTACCTGATCCTTTCGTTTTGGTCATGTTGTTTTCCCACCTAAAATCAGTTTTCAGCAAACGAGTCAAACCCCCAAA
CTAGCAGTGAGGCAACAAACTTGGGTAAGACTGGAACAACCTCTGAACAAAGAGGTCACGAGCAAGGAGATGCGACACTAACGGAGCCAAGTCAGAACTCAGAACTTGATGCCCACCATA
TGCCTAAAAATTCCCCAGCACATCAACGATTTGGTAAACTGGTAGGCCCTTAATTGGTGCGGCCGTTAATTGTGTTTAGGGTTTTGGCTCGTCCATACATCTCCGAAGCCCAAGTGCTCG
CGCGCTGGGAGCCCTCCTGGTGAGCAAATCCGGACAGCTCCCTCCCTTCCCCGAACTTTCCATTTTGGACAACTTTCCATTTCCGAAATATCATAACTTTATACATAACTTCGATGCATA
ACTCTATAATATAATTTTTTATGAGATGATTTTTAAACACAACTTCAATAACGTGTAGAACTTATGTGTACAACTTTTAGGTACAATTTGTAAGAATAACTTCAAATTTTATTTTTTAAA
AGATGTAACCTATACGCACAATTTGTATGTATAACTTTTTCCCTAACAACAATTTAGGTGATAAATTTCGTAATACGACTTTCATGATATACTTAACTTATACACATAACATTTGTCATA
ATTTTAAGAGCATGTTGTTAAAAGAATTTATGCAGATAACTTATACGTATATACAATATTTACTTGGTAAAGAAAAATAATTGAAAAGAAAAAAAAACACGCGCGGGCCAGCACATGGCG
GGGTCGCGTGGGACCCACCCTCCGCGTCGCGCTGCAGCGCCTTGGTTCCTGTTTCCGACGGAACCACGGTAAGCGCACTGTCAAGCTGCACATTAGTATCTTTAATTAAAGCCGCCCGTC
TGATCAGCATCTCACGGCTGACGACGATTCCGTGCACACAGGAACGTGCCCAAAAAGCGGCCCCCTACTGCTTTTGATCCTTTTTTGCACGGTGACAGGCGAGGTACGTTGGTAGGTGTG
GGACCGCTCGTTGAACCATGCGCGTTCACACCACCAGTGGAAGTCCAGGCGTTACCAAATCCCTCTCCTCCTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGGTTCTACTGG
TGCGTTCATTTAGCCACATGCATCGAGGAACGGACACACAAGAACTGAATGAGGAAACTGCAATTGAGCTCTCCTTTGAAATGGAAATTTTACAGTGAACACATCGGTTTCTCGCCTCTC
GCGAGTGTTCAAGAATTGCAGTAAGACGATCTTGATCCTACCAAACTCCGTCTCCTCGGAAACAACGGTTCCGGCGATCGCCGTCCGCTCACCCTGACCCCGTGGAGTCAACTGGGCTTG
GTCTACCACATCCGCTGATCGATCTGGCCAGTGCGCGACCGAACTGCCTCGGCAGAGTCAAGTCGTTGTATAGAGTACTTTTTTCCTGCATAAGGAGTCGGAAACGGACCCGGCTCTGAT
GAGTGATGACTGATGACAACGAACCGCGTGGGGTCCGTCAGTCACTCTCGCTCACTTGGAAGCTCGGCCGCTGAACCGTCTTACGAAGGCTCGTCTCCCGCGTCAGGACTCATGCAGGCC
TGGCGCCGCCTATATATCCCGCGCGCCCAGCGCTGGCTGCCTGGCTGCCTCCGGTCCTTTGCCAGATAAAGTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAGATAAGAGTTGTTGTTGT
TGGTTTGGTCACCAAGGCGTAGCTAGAATTTTAGCAAAGAGTATGCCACGACAACTTTTTTATATTAGCATAGATGTATGTGCGACATGCATGTGGTATTTAAAAATTTAGCAACCAAAC
CAACAAAATTTTAAAATTACAATTTGAGGTTTATAATTTATTTTCTAAATAACATAAGTAATAGGCTAATGCGAACTTTGGTCATGTGTGCGTACATGGATGCCACTGGAAATGCATGGC
CTCATATAATGAGATCCCTTTTCCCCATATTCAAACAATCCACCTGTTCTGCAACCTGACGTTGACTGACAATTGTTGTTGCCCTCTTAAACCTCTTCCCATCCAGTGACCCATCGAAGA
AAAAATAATTTGTATTGATGTCATCACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCAGTTAATCAATAGAATTTCTTCTCAGGCAGAGAGACGAGAGTCACCTCCTT
TCCACCAAGCAGTTACTCCCTCGTTTTGCCTTCTTCAAAGATAAAGTAATCAATAACAATCAAACATTCAGCAGGCCAGCAAAAGGACATCAAAACTTCAACGAGGAGTTGCCACTGAAT
TAGAATGCCACAAAGCTACATTTTCCTTCAAAGAAAATCACCAACAGAAGTTGTGGAGGATGACAGTTTGTCTTGAGTCTGGAAAAAACAAATCGTTCCTACAATATTTGTTTGGTAACT
CATCTCTATCACGCCTCTCTCTAATAATCTTGTCTCCTGTGGAAATCTCATCTCCCTGTTTTTTCTCCACGAAGCAAGAAGGTCATCGCCAACCATGCCAATGCCATCGGCCGGCCTGCA
TCCCCACTGGCCACTGGCCGCTCGTCGCACTTACGGGAGACACCACTCTAAGCAGCTGGCCCTCCCGTTGACCTTTTACAGGCTTGTGTGGACGGGGGGCAGGGGCGTCATCTTCGAGAT
CTTTGCCTCGTACCACCGAGCTCCAACTCCACCATACAAACAATCAAAATAATTAACACTTTATAAATTGAAGCAAGAGATATGTTAACAAATCAATTCGCACGTGATTCTGATTCACAA
CACATGAGTTCGATTTGATTCACAACACAGCACAATCACAAATGAATCGTTTACAAACAAATCATACACTATCACTTACAAAGGATACATTAACTGGCTTCTCGTATCCGCAAGCTCCCC
GCTCGCCATCTCACCTGCACGTGCGGCGGCTGGCGGCCAGGGGCCAGCTAGGGAGGGCGCCCGCGTGGCCGGCGGGATATGCGCCGGTGGCGGCCAATGCCTTGGGGCCTGGCCAGGGAG
GCCCGCACGGCCAGGCCGGGGTGCCCCGCGCGCGGCGGCGGCAGCCAGTTGAGGAAGGAAAGAGTAGGAGATGGAGGAGAGGAAGCGGTGGAGGGAGAGGGAGGCCAATGGTGGGGAAAG
ATAAGGTAGCGGGGAGAGAGATAAGGCTAATGGATGATAAAGGCCGCTAGGTTGGTGCGGAGAGAGAGTCCATCGGGGGAATAAAAAAAGAGGGATATAATCCCGGTTGTTAGTTTCTAC
CTGCAGCTGCTGATGGTTGAAGCCACCGGCGGACGCTTGCCGCATCATGTGAAGCTAGTAAGATGGGACCACTTTCGCTTCTGCCACCATAGGCGATAGCGTAACTATTATACTCCGTTG
ACTTTGTGTAATTTATGAAATAAATGTATTGTCAAGATATATTTCACGTTGGATTAATCAAGGACTTTGCTACTCCGAAATGACTGTGAGCCGTCAATCTGGAAGACTTTTTATTACATA
TTACCTCCTAGGAGGTAATACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGATATATTAGTTGTAAATTAACATGCATAATTAGATCTAC
CGTGATTGACACGTGATGGAGCCTCTGAGTGTAACATTTTTCCTTTTTTTTTCTTTTGGAATGATACGTGAAGGGAGCCTTTGAATACTTGAGTTTGTTTTTTTATGACACGGTGATGGT
ACCAACGAGAGTTTGTAACGTTCTTTTGAAATGACACACGATGGATGCTCCCAACATTTGTGTAACTTTTTTTTGACATGAACAACTGCCAGCGCTAACGTGACCTTGTATACCATGAGC
CATGACGCTTCTAACGTGATTTGATCAAAGGCAAAGCATGTGTGTGATCAAATGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNTACTTCGTATGCTTTGACTAAATCTTGTTCAAAATGTTTAGGGTTTTTGGCTCGTCCATACATCACTGAAGCCCCTGTTCCTGTTTCCGACTGAACCACGG
TAAGCGCACTGTCAAGCTGCACATTGTTGGGTCATTAGTATCTTTAATTTAATTAATGCCGCCCGTCTGATCAGCATCTCACGGCTGACGACGATTCCGTGCACACAGGAACGTACCCAA
AAAGCGGCCCCCTACTGCTTTTGATCCTTTTTGCACGGTGACAGGCGAGGTACGGAGGTTGGTGAGGGACCGCTCGTTGAACCATGCGTGGCCGTCAGTCCCGCTCGCTCACTTGGAAGC
TCGGCCGCCGAACCTTCTCGCGAAGGCTCGTCTCCCGCGTCAGGCACAGGCCTGGCGCCGCCTATATAGCCCGCGCGCCCAGCGCTGGCTCCCTCCAGTCCTTTCACAGGCCACACAAGA
CAAAGAGGCAGCTGTTGGTTTCGTTGCAGCAGAGTGCCTAGCCATCCAGCAAAACCATCAGCCGCCGCGTCGACCTCGGCGTCCGGCGATACTTTCGCCGATCCCGTCCCTCCCTCAGGG
CCTCAGCGGCGGGGGCACGCCATGACGAAGGTAATTTAATTGCGCGATCGAGCAGCCATCTCACCAACAACTCCAGCTCGTCCAAGCTCACGCCCCTTGCTCTGTTCCGCGAACTGAATC
TGAATTGATCTTTGTTGTCGCATGCAGCAAAAGATCGTGATCAGGGTGAGCCAGCTGGCGAGCGAGAAGACACGGTCCAAGGCCATGGCGCTGGTCGCCAAAGCGGACGGTACGCACGGG
CACGCGTTGTTCTAGTGTTCTACCATGTCGATGCTCTTGTCCTGTTTATATGTGAGCTACGGCCAGTGCTAACTGTTCTATTGCTGCGTGCGTGGGTGGTGCAGGGGTGAGCTCGATGGG
GGTCACCGGCGACGGCAAGGACCAGCTGGAGGTGGTCGGCGACGGCGTCGACACCGTCTGCCTGGTCCAGTGCCTGCGCAGGAAGATCGGCCCCGCCGAGATCCTCAAGGTGGAGGAGGT
GAAGCCGGCCGAGAAGAAGCCGGAGGAGAAGAAGCCGGAGCCGCTGCCATACTGGTGGTACCACAATTACTACCACTACCACCCGCCGCCGCCGTGCTGGTGAGGTGGTGGTGAGCCGGT
GACAAGCCGTTCAGGGAAGCGGCCGTTTCGGATGGAGTAGTAGTTGGAATTCAGCTCATGCTTGCTCTATATTTGTATTCGGGCTGTTCTGTATTTCAATGGAAAAAAAAAGGCAAAGCT
GTTCATCCATGGTTGCTCTGCTTTTAGCTTTTTTTTTTAAGGGAAGATCTGCTTTTAGCTTTCACCCCTGTCCACGTATATGANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGACAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNACTTCTAGTTGTAAACTGAGCGTAGCTTAACTGGTAAGGGTTCCTTGTGGTGTAACCTA
CCTGCCTGGGGTCGAGTACTCGACTCAACACGAGTGCTCGCATATTCCTGGATTTATTACAGGATTTAACCAGTGCTATTCTTTTAGTGGTAGGCGACATGCCCATCGACGCAAGGCGCA
TGTGGTAATTTCATCAATCTCGAGGATTTGTCGGCTCAGTCTTTCGGAGGTGCTCGTAGGAGTAGAGTTGTGTGTGTATTCGTAGAGGCGAGTGTGCATGCCTGTATGCCTGTATGTGAG
CATCTGCGTCTGTACTGCGCGATTCCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTTTGTCTCTCAAAATTACGATCTATGCGACAG
TATATAACTAATAAAAGGAGGAGATATATGAGCTAACTACCCATGAAAATCAGAGAATACATGATCTAACCACCTAGAGATTGTAACCACGTAGAAANNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCAACTATCTTATTCAGTCGGAGCACACTCGTTTGTGCGTGCCTGCACAGCGTGTTGGTGCACCTACTAGTAGGCA
GGTGCGCTCGGCTTGTTTGTCCAGGCCGTCCGTTAAAAAAAAAAAACACGTAGAGGCAACGTGGCCAGCAGGGCAGTGGGTATACAAAATTTGCTCTCGGCCCGATCCGGAACTCCGGAT
CCCGTCGAATCAAGTCATTGCCCACAGTCTAAGCGCGTCCTGCTCGATTAATTATTACTGACGATCTTAGAATGCTCTTCTCTGCTGACGGAGCTTGATTATCCCTGTGCACTAGACTAC
TGCCAGTAGGCATGCAGTAGGTAGTGTAAGTTCCGTGTCCGATTGTATTCCTCCACCCGTATACAAAAGAGCGGTCAGCAAAGCTCTAGGTTGTGTTTCCTTCTTCATGTAAGTTTGCAT
GTCCACATGCATGTGATTTGGTGTGCGCATGTGCCAACATGTGACGATAACGTACGTAATTACGTCGCAATCAGCAGGTACTCCGTATCTAGCATCAAGAATGGCCGGGTTCTCAAACGA
CGTGCAAACGGAACTGCGAACGTCATCTGACAAGAACGAATTCACGTCACGCCCACATCGTAGTGTTTGTCGTAGCCTGATCGAGATGGATCATGATGGGGGTGCACAACTTGCATTTTT
TTTTCCGTCGATCTGACATATAATACCTTGTAAAAGCATTTGAACTGATAGTGATTTGAAAGCCACGTCGGAGAAAGGGCTCAATAATGCAGTGTTTTCCGCACACGTCTGAATGAAATT
CTTCACTGTTAAGTTGGCCAATGTTCCTATCGTCTTTGGTTTCTTGGCCCTAATGAGTTGCGAGTTGGTGAAGTCTACAACTCCAAGTAAACCAAACAAGTGGCCCATCATAATCCAATT
CATCTCTCTCTTGTGCGTACAAATTTGTGGTTTATCTCTAATTCTTTTTTCTAATAATTTTATCCCTAATTCTTAATACAAGTTACTACCCTTTAGGGGAATGCTTTTTTCCCTCTCTTT
GAAGCTACATGAGATTTTCTTACGATATTCCGTTCTTAAAAAGGATTTTCATAGGACATCTCTCAATATTTTGAACAAAGTTTGTTATATTGCTTGGCTCCTATGACTATGAGTACTTCT
TAAAGAAATCTACAATTTCCATGAGATGTACATATGAAGATGGGCACGGCAGCGATAAGAGTGATCAAAGCACCGTGTGGTAGCCAACAACTAGATTGAAAGATACAGCTTCTTGTTTTC
TCAAAAAAAACAGAGAGAGAGAGAGAGAGAAGATGCAGCTTCTTAGAAAACTCTACAATTACTACTACACGGCTTCATATAAGTTCTATACCAAGTGCCTTTTCATCCATTGTTGACCAC
CAAATCGCCATCATATCTACTTCGATATGGAATCGACCAATCAAGACTCGTCTCATTCTCTTGTCAAGTAATTTGACTATTGCAAGTGGAATTCAACGTAGCAATCTCTTTGGAAGGAAC
GGATTTACACCACGCCGAGGAAAGCGCTTAGCGCATTAACGAAGAGCTTGGTGCTGCAAATTTATATTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTAATTTCTTGAGCAAAAGGCTAGGC
TCGTCTAGCTGCACAATCAGGACGTATGAAAAGGTAATCGTTCTTCACTTTGCGTTAGGCTCTTGGCTCTTCCTTTCCTCTCAAGTTCCTGTTGCCAACATTCTATATGAGAAATAGAAC
TTGTGTAACAAGGAAGAAATGCTCATGACTGATTCAATGAAACGATCCAGACATAAATTTTCTTTTGAAATTAATCTCATACACAATCACTGTTACTTTAGTTGTTAGAACTATCTTAGA
CAGCATAATTGCAATCACGTTCTGACAAATCAACTGTCAAGAATTCAGTGTCTTACAGATAGTCTCGCCTGATTCCCTTTTTTTTGTTTGTTTCTGTTGTTGTTTTCGCACCTAGAATTA
TTTTTCAGCAAACGAGTAAAACCGTCAAACTAGCAACAAACTTGCGGAAGACTGGAACAAACTTTGAACAGAGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGT
TTTGAACAGAGGCAACGGGCAAGGAGATGTGACACCTGCCACATGCTCTCAAATTCCACAACATATGTTGGACTGCAGGTAAATATTCTATCACGTTTGGAAATTGGAATCTGTAGCATA
GTAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NTAAGTAACAATACGAAGGTTGGAAACCGTTAATTCTTCTGCCAGGAAGTGTTAATTCTTCTGCTTTTTGTCTGAAACAGGTTGTGATCATGAGGGTGCAGACGAGGCGCGACAAGTTCC
GGAAGGACTCAGGTCGCAGCTGCTTCGACATACGGTAAGTGCACTGTCAAGCTGCACAATGTACGTCGCCGGTCTGATCGGCCGAGGACGATTCCGTGCACGGAGAAACGTACCAAAAAG
GGGCTCCCTACTGCTTTTGATCTTTTCTCCGGTCATCCACCCGGTGACGCGAGGTGCGACCGCTCGTTGACGCATGCTTGTTCACGCCACCCCCCAACCCGTGAAATTTAAAATCCAAAG
CGTTTCCAAATCCTGCTAGTGGTTCTGTTGGTGCGTTTAGTTGTACTACTACCTTTCCATGTCATCCGCGATGTCGATCGGATCGATGAACGGACAGACATGAACTGTTGAACGAGGAAC
TGCAATTGACCTCTCGTCTGAAAAAGGAAGGAATTTTACAGTAAACAGTTCAGTTCTCGAGAAGGATTACACAATGGCAAACGATCTCAATCCTGACACAATCAATTCCGTTCCCTCGGA
AACAACGGCGCTGGCGATCGCCGTCAGCTCACTCCACTGCCTCGACTCGGTCTACCACATCCGCGGGTGCACGACCAACTGGCTCGGCGTAGTCTCCGCAAGTCGAGTCATTGTATACTT
GAGGAATCGAAAACGGACCCGGCTCTGATGACAACGAACGCGCGTGGGGTCCGTCAGTCCCTCTCGCTTACTTGGAATTGGAAGCTCAGCCGCTGCTGAATCTTCTCACGAAGGCTCGCC
TTCGTCTCCCTGGTCCTCGATCACTGGCTATATATACCGCGCAACCCAGCTTCTTGGCAAGGCACACCTGGTGGCTGCATCTGCAGACGAGCATCGATCGATCAGTAGCCAGAGGGCGTA
GCCATCCAACCATCAGCTGATCAGCCTCTGATCTTTCTGTGCCCGCCGCAGATCCTTTATCCTCTTCCTCAGGCAGCACGCAAATCAGTCGAATGCGATGAAGGTAAGCGAGGAACCATG
TCAATCTTCAGCTCGCGCCCCTAGCTCTGTTCCGCGCTGTGCCGCGAAGATGAACCCATACTCAATTGATCTTGCTGTCGCATGCAGCAAAAGATCGTGATCAGGGTGAGCCAGCTGGCG
AGCGAGAAGACCCGATCCAAGGCCATGGCGCTGGTCGCCAAAGCAGACGGTACGCGCGCACGCGTTCCACCATGTCCAGGCTCTTCTCCCTGTCCATTGTCCACGGCCGGTGCTAACAGT
TCCCGACCGTTCGTGTGCGTGCAGGGGTGAGCTCGATGGGGGTTACCGGCGACGGCAAGGACCAGCTGGAGGTGGTCGGCGACGGCGTCGACACGGTCTGCCTCGTCCTGTGCCTGCGCA
AGAAGATCGGCCACGCCGAGATCCTCAAAGTGGAGGAGGTGAAGCCGGCCGAGAAGAAACCGGAGGAGAAGAAGCCCGACGAGAAGAAGCCGGAGCCGCTGCCGTACTGGTGGTACCACA
ATTACTACCACTGCCACCCGCAGCCACCGTGCTGGTGACCGGACGTTCATGGAGGTGGCCGTTAGTTTTGGGGAATTGGAATTCAGCTCATGCTCGCTCTATATTTGTGTTCGGGCTGTT
TTATATTTGAGTGAAACAAAAAAAAAAGAGGCAAAAAAGCTGTTACGGTGTTACCCATATTCTATCTGTTTTCAGTTTCCACCCCCTGTCCATGTTTGGTGCTTGGTCGCCCTTTTCGAT
ACTTTTCCCAAAAGGCTCACGGATTTGATTTTGAATCAGGCTTCGAGGTTCTGGCAACTTAAATAAAACAAAAGTTGCTATCCACAGCCCACCCATACTGTTATAGATCCTGAAAAATTG
ATGAGTGGTTTGGCAAAATTTCCAAAATTCCCTATCAAAAATCGACAAAGTGGAATTTGGCAAAAAATTTCAAAATTCCCTATCAAAAACTGACAAAGTGAAATATAACAAATGGAAAAA
ATCTACAAACCCAACAGGATGCATCCACCTTTTAAATTTCTCATCAATATCTCATTTCCATTAATATTGGCTTTAAAAAATTTCTTGTCCACATCTCATTTCGATTAGTGACATCTAAAA
TTTTTCATCTTATGAACAAGCTAATGTAAAGCAAGCTCAATTTCTTCAGTAATATGAAAGTTTTTTCACTTTCCAACTCTGGCTTCAGGCCTAAGCATTTGAACAGTACGGTGGGGGAAA
GGTTCGATTTTCAGCGATGAAATGTTAAAGAAAGAACCAAATCCGACCATTTATTTTTCAGTCTTTGCAAATAGAATTGCCTAATTTTCCCCTGGTCAGTATTGGTCTTAAGAACAAGTC
AGTATTGGCAGACCGTCACAGCGACAAGAGTCAGAAAGAGGTCCACGCTCCGCATTGTGGCATATGTCGTTGTCACAAAAGAATGCAGTGCTTCGCAAGTATACGAATTTAGGGGGACGT
GATCATTGAAAACAACGGAGCACCATCATTTTATATGTTTAACCATGTACCTGGACGCATCAGGTGACAATAACGCAATTAGAATGGACTACTTGTAAACGAACATTTTTCAGAGTGAGA
CCGATCGTTGACTCGTGTGTTCACATCGATGATCGATCCCATTTTTTTTTTTAAAAAAGTCCCATTTTAAGAGCTAAGTATATATAAGATCTAGCTCTTCATTACTATGGGTAATGTAGT
AATATTACATTGTAAAAAGTGATATTTCAAATGGAATGCTCTTTTAAACTTTTAAACTTATGTTAGTGTCAAAAATAAAATTATAGTGATGCCATTTGCGTTCTTTTACCATGATACTTT
TATACTACTTATACTACTCCTACTCATGTATACTACCCATACCACATGTGAAGGTTTTCAATAGTATACAATTAATTTTAACCGTCGGATACTTTTATACTAGTCCTTTTCGAACACTAG
TATAGTCTATTATTTTATACCGTAAAAGAGCTCAAAAGAAATAGTTGAAAACATGTTAGAATGTTAGAAAATCGAGGAACCATATCTTTCAAGAGTCATTCTATCGAAGCCAAATCTTGG
AAGCTATATGTTTTGGAGTGTTAACTGCACAAATTTCTCCATTTTATATACTGTATACCCGATTTCTAGCACAATAAATTCTACAAAACCAGATCTAACCTAACCAAGCTTTGATGAGAA
AAATTGATAATTTGTACATGTCCTGCGGGCTACATGCCTACATGTCATACCCTAATATTCAAAACCGTTTTTATGCCCACGTTTCTCCTTTTGCACAGAGTGACAGACCAACCCCGCGTT
TTGGCCAAACAAGAGATTACAAACAGAAAAGGTGAAACCGAGCACCTAATTTGATTTTTTTTTAATCAGCACCGAATTGGATTTGATTATACATAAACAGCACAGGTGATCATGTAAACA
GACAAGTATCTGAGCCCATGAGGCAAACAGGGCAAGCATGTTAATTAACACCACGTCAAATATGCGCACAACGCTACATCTGCACGAGGAAACGAGAAATCAAATTCTCCTCGCATAAAG
GCAGCAAGTACATCATTAGGTAGTACAAGTTATCACTTCAAAATAAACCGCCATACTACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAAA
TGGAACCGTGTGTCAGTCTCCTTTTATTTCTCTCCTCTCGTGAGTGGAACCCACATGTCAGTCCCTTCTTCTTTCCCCTTCTCTTCCTCCTCTGCTCACCCTCACCAGCAGCTCTGCACG
TGATTCTAGCACTGGAAGGAGAGAGATTAGCACCTGAGCGGCACTAGTAGGATTGACTGATTCTAGCACTCCATTTGCCTATTAGTGGGGGCTCAAGGGTGGCAGGCACGGAAAGGATGA
ACGCCCGGCTGCACGGCCTTGGCGAGCGGCCCCGCAGGCAGCACGAAGGCCATGGCCAGAGACGCAGGGGCCCACAGGCGGTGGCAGCAGGGCAGCCCGAACTCCGATCACCCCCAAAGG
CCATGGCCTGACCGGTGCGCCACTCCCCTGTTACCAATCGGTCGCCACCGCCTGCCTCCGGTCGCTGCCATGCTCGGCTCCGACGCCGAGCGGCTGGGTGGCCTCCCCGCGCAGTCCGGC
GATGGCAGCACATTCCGACCGTTGGTGTCAGGACGTCTGCAGTAGGTGAAGGCGTCGGGGGCAGCGTGGCCTGGCGGTCAGGAGCGGCGAGGTCCGATGGGCCGAGCAGCAGAGGGAGGA
AACGACGACGGGGAGTGGATAGAAAAATTAGAAACAAACCGATATGTTATGTAACGAGTGGCACAGTATGTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTTTTCACCACCAGCACTTTCTACTAAACTAAACCGGTGCAAATGGGAAGCAGGACCAATAAACAGTGACTTC
CAACATGCAGCCACCGATACGAAGTTCCTTGGTGCTTGCACCCATTTTCAGAGGTTTAAAGCCCTTTTCATCTGTATAGATAGCAGAACCATTCGTAATGGTGGCCGCAACCTTCAGCTC
TCTATCACTGTCAACAGAAACAACCTGCCGTGCAAAGCTGATCTTATCACCAGTAAGAGGCACGGGATCATCTGCAGTCTCAAGCAACAAAATCCATTGTCCTATGCTGGCATTGGCCCG
AAAGATGCAACGAAAACCATCTGGCCATGGCCCGGAAGTGACTCGCACTTCGATTGTAGCTTCCACAGAACAAGTAAGATGGCCAAGCATCAGTTCCAATGTGCTAAGTCTGCTACTGTA
AGATCGCTCAATCAAGCATGAGTGACCGGAAGGGAATTGCCCCAATGAAGTAGCTAGAAGGCTCAATTCTTTGTCATCAGATCTAGTAGCACCTTTCACATACAATGAAGCCTCAAATAT
CACACGACCATATATCATGACAGCACGCACAGGGCCTGTCAGTTCTAAATATGGATTCTGCATGCAACACCATAAATAAATAGTAAGAAAACTAAAGTGAAACAGGAGGTAAGCATTGAG
CAGAATAATCAATATGCATACAAAACACCAAAACAGGCAAAGTGCATGGCATGAAGTATACAACAAATGATGAGATAGCTTGATGGCTTCATGCATCAGCAACAATTAGTAAAAGGGACA
TCTGTTGCATGCTTATCATAGCGTATCGTTTGCAATTTGTAATCAACCCCAAAACATTGTCCTTGCCAAAATACATTGGAAACTGCCATAAAACTATCAACTATGCAAGTTAAAACAGAT
TGAGGGACAAAATAACAATTGTCACTGTCATGTTACCAAGGAAACGGACACACCCATCCGCTCACAACAGTAACATGATTCCTACTTTCATCTACAAAGGTGATCATTTCTTCATGCACT
GATCAAACCAATACACATGACCAAATTTAAAGACATGCCAAACTTATGTTCCTCTACCAGCATGTTTATACAAGGTTTGAGCTGTCTACATGATTCCAATGTAAGTAACAAGCAGGGTAT
CTCACCACTATGTATAAAGCTTTATTCTGAAAACAACAGCAGTTGGTAATATAATTAAAAGATTATTTGGTTAAGAGAAACGTGTACAATAACTGTATGGTACCAAATATATACATGCTT
GCATGCTAGCAATAAGACATTAGCTAATGATGCATTTAAGGAAGGGTAAGACTGGAAAAGGAAGTCTAAGGCAATGTTTGGATCAGCTACACATTATGAAAACCAGCTAAAAATATCTGT
AGAGGATCAAAACAGCCCAGATTATGGTGTAGATAAAAAAATCCAACCATCCAGATTCCTATAATCCTGTAATCTGGCTCCACCCAGCTAACAGTAGATATTGCATGGGATTATTGCTAC
CCACCACCTCTATCCAAGGATCCAAACAGCCCTAGATATTGCTATCAAGATTTAATATCCGGATTTTCATAATCTGTATCCCTAATCCAGATTTCTATAATCTCTAGCCCATCCAAACAT
GCCTTAAAATTGCCTAGAAGTTATAGAACAAGGATTACAAAGATAGTACAACAGGCTAATACAACAAGCTGTATTTTGAACCGGAGGGAGTACATGGTTTGAGCTATCTACATGAGTCCA
AAGTAATAGGCATCGCCACACTAGGAATGGGAGTCATGGTAATTTGTACAAGCTATAATATCGCATTACCATGTACGAACGCTTTATTCTAAAGACATTTGGTTCAGATAAACAGTTGGT
ACAGCAACTGCATGGTATAACTAGCATGTTTGCATGTTAACAGCTACACAGGGTTCATAAAAAAGTATGTAGGAATAGGCAGCGCGACAAGAATCAAATAATGTAGGAATAGGCAGCATG
GCAAGAATCAAGAAATGTAAGAATAGGCAGCGCAGCAAGAATCAAGAAATGTAGGATCAGGTGGCACAGCAATAATCAAGAAACAATAGCTGTAAGTAAGAAACACTTTGGGCCTGATCG
GTGAGTATCTGACATTTATCCCTTTCACGCTCAAAGATAATATTATGATTGTAATCTACTGAGTCACGTAGGGCAACCAAACCAAACACCTCAAGCGGCCACTGTAGACCTCCAGTTATT
CCTCCAACTTTGACATAAAATACTTGTAAAGTCTGGTCAGCAGTGCCACCGTGTGGCAGAGTATTATGTGTAAAACGCTTGCAAGGGATATTAGCTGCATGTAGTCAAAGGAGATTTCAA
ATGAGTTAGGACATTCGAGCCCAATAGCGGATAGTAGCAGCAGTAAGGACTAAGCAGTAACAGCAGCAACTAATATGTGCATGGATGGCATTCAAGTTATTCTTGTCCATTGATCTAGTT
CTGATCCTACAACATTTATATCACTTGATATCAAAGGAGCGTCATTGTGACTAGATTGATCTATAAAGTATGAAATGATTCGAGAGATGACAAGTGCTGAACCAAAGCAACAAGAACCAA
CTTAAGTAATTAACGTGCAAATCAAGAACGAGATAATCAACAAGTTAACTCACTCTTTCTTATCGAAGCAACCGTAGTTCTTCAAATAGAATTCGTCCCACCTCTGCCTGAACAACCTAG
CTTCAAAGGCGTAAGGGTCTGTTACCTTCTCGGGGTTCCTTTTACGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNACTCCAAATACTTCTCATACAGCGGCTTTCTCTCTC
TCTCGACGGGTTCCATCTTCGACTCTTCACTCCCCACTTCCCCTTCTCTCTTGAGGTCTCCATTCCTCGCCTCCTCCCTCTCCTTGTCATCCGGATGACCATCGGTTTCCTTCATCCTCT
TCTGCCGCTCCGCAACTTCCGCATCAGAATCCTCCACACTCCCCCGCAATCTCCGCAACTGAGTCTTCTTCCCAGCTTCGTATTCCCCGTCGCCGTCGCTCTTCCTCTCCGCCTCCGCCG
CCTCCAGCTTGCACGAGTAGTTGCCCGCCGTCGCCGCTTCTGGGTAAGAAGCCTAGATCTGGTTTTTGCAGGGGCACAACGCCAACACGTAAATATGAGTACTTCGTAACCAGGCTTCTC
AGCCCAGTCGGACTCAGCTTCCGGGCCATACTAGAAACAACGCGCGGCGTTGCCGCGCTGGGCCTGGTAGGCCTTTACTTGTTTCGTTTTCATTTCCTGGCTTGGCTCTTCCTTTTCCTT
ACTTTTTATTCAACATTTGTACTAATATATATTTTTGATATATTTTCCTGTGCTCTTGATTTCTACTGATATAATAACAATTATGTTCCATTCAGTGACTTGCATCATGTCCCGAGGTAT
TTTTTCCAATCACTAATTAAAAAGTACTTTCTTTTTGCACCCAAGCTAATCGGGTAACGTCGAGTCGGGCTAGTGTTATTCAGTGCTTGGATGAGCATCAAAATGATTGATCAACATGAA
ATTAGCGCCTTAGTACTCCTTGTTTTTTTACTCTGCCCTCCGAGTAAATTAGATAAGTCGAGACTTACCAGTATGCTGTTTGACTGCAGATCCCGAGGTACCTCAAAATCCTGTTAATAT
CCCAGCAATTCTAAAGGAAGAAACATAAGACTAGAACTGCAGCTGGCATATCGAATTTTGGCTCTAGACAAAAGACATGACAATCTTCTGAAAAGGCATCAAATCCTCATGCAGCATTTG
GATAAGGAGCTGTCACAGGGATCAGCCATTCACTATTTCCTGTGAAAGTACTCCAATATCCATTTTGGAATTCCAATTCAGCGCCTCAAGAGGCTCTGCTGTCCTTGAAGCTTCATTATT
GGTGAAGTCAGCATGCCTCTTGCCATCATAGTTCTTGAGGGCCATTTGTTTTCATATTCTTCGGTGGGTGAGACTGTATAGAGAAATAAGAAACAGTTTGTAAACAATTTAACCAGATTA
TGTTTAAAAACAATTATTTAAAGTTTAAGAGGAAGCAAAAGACAATGACTCAGGATGATATACAGCTTTTCCAGGCAGGGGAAATATTTAATGAAGCCTAACTGAGTCCAGATTAGGACC
TCTAGAGTCAAGAACCAAAATCTTAACTATGGGCATTGAGGTTGTCGAGCTGATAATGATCATTTCCAATGCCAAAACCAATAGTTCACAATTAATAACATGCACACAGAAATACCAGGT
GCAAGATTTAGATGGCTACTCGTACCTTCTACGTCTTCAGCACGGCCGTGGCCACCGACATCTCGCAGGTGGCAGCGGCATCCGGGTGCCTCCTGCTNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNTCGTCGACGTCGCCGCGGCCGGGGAGCGTGACGAACGCAGGGGCGCCGCGCCCGTCGTGCTCGACGGCTCGCCGCCGCCAATCGTCCTCGTCCACGGCA
TCTTCGGCTTCGGCAAGGGGGTACGGTACCGAAACTCTGTCCCGGTTTTCTTCTCTCGCGCTTCCGGGCGGGGCGGTGGCCGGTGGGTGTTCGGTGAAATGCCGCGGCGGCAGTTTTGCT
CACGTGTTTTCCCCATCTTTGCTTGCTTCCCCGCGCAGAGGCTCGTGGGGCTCTCCTACTTCGCCGGCGCCGAGAAGAAGGACGACCGCGTGCTCGTGCCGGATTTGGGGTCGCTCACCA
GCATCCATGACAGGTGGGTGGGTCAGAAAAAAAAAAGTAGCAACATACTACTTCCGGATCATCATCATAATACAAAACCTGCCAAATATTCCTGTTTGGTAGTCGTTCCCAGCAGCTTTA
CCTTCTTTGATCATCTTAGTAGTAAATTATGTTGCTTAAAATGATTCGATTGTTCTTGATGCCGCAGGGCGCGCGAGCTGTTCTACTACCTCAAGGGTGGGCAGGTGGACTACGGCGAGG
ACCACAGCAAGGCTTGTGGCCACACACGGTTCGGCAGAATCTATCACACAGGTACAGATTCTCAACAACAGAATACATTTGCTATGACCTTTCAGGAGTTTCTTTTGGGCTCATAGTTCT
GAAATTGCTGTTCTAACTTCTACTTCGGCGCAGGGCACTAACCTGTGTGGGATGACCAGAGCCCGGTGCACTTTGTTGGGCAATCGGCCGGCGCAGGTTGTGAGTAGCCCTGTTCACCGG
GTTGGTGCCAATCCGTGAAACCCGCCAAACCAGCCTGTGGAAACCAGCTACTCAGGCCATCTGGGTTGGGCTAAACCGTGATGGCTAAATCGTGATTTAGACCAATAAACCTGTCTAACA
GGAGGCTCATTAGCAACCAGCACCGCGCGGCAGCGACAGCCGGGCTGCTAACGATTACACGAGTCCCATTAAATCAAGCTAAACACAGATCACTGTATGTTACCGGCAACTAATCGCAGG
GATGCTCCCAGGACGCGGTTGTCACGCAGCGAGAGGACATGGAGGCCCCGCAGCCCGCCGAGCGTACCCGGCCGCCGATGAGGGTGACGCCCGGGAGGTGGAGCTCCACGACCGTGGCGT
TAGCCACGTCGCACCGGACGCCGGTCCAGGTGCAGGCCGACACGGACGCCTTCTAGCCCAGCGCGCACTCGTGCGGCGTGCCTGCGAGGAACGCCTGCAGCGTCGACGTCGACCGCTCCT
GCTGCGGCAGCTCTGCGGACGCACAGCCGAGCGCCACGGCGGCGGCGGCTAGCGCCAAGAGCAGCACGAGCCCGACTATTCTTTCTAGGGCGTAGCGCGCACCGGGCGGGACATGCAGCT
ACGGCCTGGATGGACGCAAACGCTGCCGACATGGGGAGCCGCTCGCAGCTTCCAGCAATGACGTATGTTGTCGCCGGTTTTAAACCGCACAAACTAACCCGCCTAACTCATAATCGTGTG
GTTTGATTTGAGAGGTTTAATTTGAGAAACCGTGTAAACCTGTGATAAACCGCCGTTGAACAGGCCTAGTTGTGAGGGTGCTGCATCAGATGCTAGCCGACAAGGTACACACTAGAGATT
TTCAGTTTCACTCACAAGTGATCGCCGTTTGTTGATGGTAGAAGAATTAGTCATGCCTATTATGTGCTTTCAGAGGGATGGTTCTTGTGACTTGGAGTACATGATTAGTGCACCATATTT
AGGATCTCGATGGCGATCACCGGCGACGAGGTGGTCGGCGACGGGCGTCGACCCGATCCGGCTGTCAGCTGCCTGCGCAGGAAGGTCGGCCACGCCGAGATCCTGCNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCGAAGGCGCAGCTGCCCGTGGTGGTGCACCCGCCGCCGCAGAGCTGCCCGTGAGGTCTCTTGATTTTCACTACTTTG
GGGCCAAAAAGAAAAAAAATAAATGTTCAGTCTTTACTCTGGCACATGCATCTCGATTTCTCAATAGCTTGCTTTAGTTCCAAATTTAAATTTTTTGTTAAGTTCTCAAACACTTGCGTC
TTGGTGAAGCATGCATGGTAGCATGTGATTTTTGGCTACTCCGGCATGTGCCAATCTGGGATCGCGAAGTACACGTGGTGCCGTAGGATACTAGGATGGAGAGAACTGAAAGCCCAATAG
CGTGCACGATGCTGGCGTCATCTGTCAGAAAGAAACTAACGTCATGAGTGCATTAGCGCTTCACGTACGCTGACGTACGTAGGTAGATCATGATGGATGAATCATTTGCCTTTTCGCGTC
TAAAAGTGGCTTCTTCAAAAGAAAGTCGTAAAGGCTCAATTATGCAGCTGCTACTCCGAATGGCTGAATTTTCTTCTCTGCTGCCAATTACAGTCGTGCTGGTTTCATTGTCCTCGTGGG
TTGGTGAAGTCCAGAAGTAAAACCAACAAGTGGCCACTGACCAATCAGATTCCAGCTTATAAAGACATAGAACTACTCTTCCTTCCCCCATAAGCACCCACCAAATTTCTCTTTTTTATC
AGGATATGTCTGTTGTTTGCTATATAGATTTATATACCATTGCAACGTGTATTTTTGCGAGCGTGAGATCATTTTTTTCCTTTGAAGCAACATCCCAGGTTTTCTTAGNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNTCAGCGAGCCCGGGGACAAAGATGACTAAGAGACGTGATCGAAAATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAGGTACCTTTCCAGTTCTCTTGCAGCTTTCGTGAGTACATGAAGTGATCATATCTAACTGACATTGCGTTTGGTTTAATTAGAT
GTGCAGCAGGCAATAAGAGGGCAGCATGGTGGTGACGTTGAGCTTCCGGACTAAAAGAGGATACTGATAACTAGCATTCATTTTCCAGAAATAAGCCCCATGCCACATCGTTTGGCTCTG
ATTCAGCCATAATACGTATCTCACTAATGTGGTTTGGCGAAGGTGATTGGCTGGCTTAATCAGCCTTAACCGAATCTATCCCTTAATGAACAATTNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTAGAATACTCGATTTGACGTTTCAAAAAAAAATACTCC
ATTTAGAAAACTAGTTCGGTTGGGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCGTTTTGTAAAATACCTCTAAGCATTTTAAGAGGAAACAAATCATGAAACAGCTTACTACTGGATTG
TTTTCATCCCTAACCAGGAGTGTTCCTATGATCCTATCAGTTCAAGTTACTGAACGTCCGAAACCTGAATGCAATAATTTACTTACAATTCCTTTTCTCGACGATATCTATTTCCCCATA
AAGCGAAATACTTCACTTCGCAGTCGTTCTACTTTCTCATAGGAGTGGTCGAAGCAACGCGTTGTGGCCAAATAGATGGAAAGATACAGCTTCTTAGAAAACTCAGCAACTAATAAATGG
TCATGTTAGTTCAGAGCCATGTGCTTTTTCAGGACCCAGTGTTGACCAAATCGCCATCATATCTACTTAGAGACAGACAAAACCAACCAAGACTAATCTCTAGTCAAGCAATTTGATTAA
TATTGCAAGTGGAATTTAATGTGTGCGTTAGCTTTGGTCTTTGGAGCGAACGGGTTCACACCGTGGTTACTATGTTCAAGTTGTGCAGCTTCTGAAAGTAACTTTGTACATTTTCCAGGC
ACCTAATGGTTAATAGAAGTGGTTAGAGCACTAATGAAGAGGCCAGTGTTGTGAATTTGGTTTTCTTGGCCAAAAGTGCGTCTAATCACAGGATCAGGATATACGAAAAGGTGTAATCGC
ATTTCCTCTCAAGTTCCAGGTTGTCATTTTCTATCTGATGAATTGGATTTCTGGTGGATAAGGTAGTGCTCTATGACTGTTTGCGAATACTGCTATGACTGTTTGAGAATACTGAAATGG
TCCCAAGCACATTGTTTCTTCCAGAGATGATCTCATGCACAACCAGTGTTGCATCGGTAGTTCCAATTAATAATTTAATTAGTAGCATATAACTGCAATCTGACAAATTAACTGTCAATA
ATTCAGCGTGGAACCTACAGTCCCACCTGATTCTTTCTTTTTGTTTCAGCTGTTTTCACATCTCAGCTAACATGTCAAACATTCAACCTACTAGTCAAGCGCCAACTTTTAAAAAATTGA
AACACAAGAAAAAGAATTATAAACAAAGACATGTCGATGTAGTCCTTGGGCACCAAGTTAGAATCGATTCTATTACATGGTCTGAAATTCCACAGCATACACCTCATGCAAATCAAGAAT
CAACGATTAATCCCATTCCACTGATGAAAATTAAACACGGTTTCAGAAAGGGCGGGCAACCGAAAAGAGTTTCGCAAAGTCAATTCTTAAACATTGCTCATGCTTAGCCCACGGCACACA
TAGAAAGGCCCGGTGGTCTAGTTGGGATCGTTTATATAAATTGCTAGGAATCTTCTTAGCACTGGGCATTGTTCTTAGTGGGGACGCAAAGTACACTCCTCAAGTTCTCGTCGGGCCTGC
AGCAGCTGTCCTTAATTACTATATAAGTTGGATAACGGCCCTTCTCTATTCCTCAACAAACTCTGAAGTTTCAAGGTTTCGAGTTGTTTGCCAGACTCAGACACCACAGAGAAACTGTCA
CGTTGGCATCAGCAACAGACCAACAAAAATATGACGAAGGTAACAATTTTTCTGTCAGGAAGAGTAGTCTTCCGTAATTCATCACGGCATATCTCCTGCCTCTGAGTCTGATGCAACTGA
AACTCCTTAACTCTGCAACTTTTTTTTCAGCAAAAGATTGTGATCAAGGTGCAAATGACGTGCGACAAGTGCCGGAGAAGTGCTCTAACTTTAGCTGGCTCCACGTACGGTGAGCACTGC
CTACTACATGCTATTGATACACTGTGCCGCAGAGCATGGAACTGATGAACGTAACTGACAATATCGATGTGTGCGGTGTGCCGGCGTGGTTGCAGGGGTGCAATCCGTGGCGATCGAGGG
GGAGGAGCGCGACCAGCTGGTGGTGGTCGGCGACGGCGTGGACGCTACCAGCCTGGCGAGCTGCCTGCGGAAGGCGGTGAAGGTGGGCAGGGCGGACATCATCAAGGTGGAGGCGGTCGT
CGACGAGAAGAAGGCGGCGGCGACGACGACGGCCACCGGTAGTAGTGGTCCCGTGGTCGAGTGGCCGCCGCAGGGGTACCCCTACTACCACCCCGGCCATGGCTATTACTGGCCCCGGAC
GGGCGCCGTCTACCCGTACGCGGCCGGCCACTGCTACGTCGAAGACTCCGACGAGGGTTCGTGGTGCGCCATCATGTAGGTGCACGGTGCACGGATCGAGTTGGCAAGCCTACAAGCATT
TGATCGATCTCCGTATGGATCTTCTCGAGTGCTGTACTGCAGTAGTGCTTTGTGGCCGAGATAAAAAGAAGAAGAAGCGAAAGTCATGAGTGCAGCCGTGTTTAAGCAGGGGTCTGTTTG
TACAGGTTGTTTATTCCGATTTGTTTTGTGGTATTCGTCAATTTAGGAGGGTGATGGGCCTAATTGTGATACTGGGCCTTCTATCTTGTTTAAGGCCCATTTCTTACTGAAATGGAGTTC
CTATCCTGTGCTTTCTGCCCGGGAATCCTGAAGAAGAGCTTAACAGTTAACTGAAAGCGGTTAGCGCACCCTGATGAAGAGCTTAATCCATGTTGTCAGTCTGGTTTCTTTGGCAAAAAA
AAAGTGCATCTAATACACAATCAGGTATATCAAAAGGTGTAACCATTCTTCCCTTTGCCTTAGGTTCTCGATTAATTCGATTATTAATTGCCATTCCGCTTTCTGATGAATAGGGTTTCT
GCTGAATAAGGTCTCTACGAGTGTTTGAGAATACAGAAACAAACTAAGACACAGTTTTTTGGAAAAAAAAAAGGTCTCATAAAAATTTCAGTAGGACCAGATATTAGCAAAGTTTCAAAA
ACAGTAATTATTACAATCACGTAGTCACGAATCAACCGTGAAGTACTCAATGCCTAACGACATATAGTCCACCTGATTTGTCAGGCAACCAACTTCCAAATCATAGGAAAATTTGAACAA
AGGCATTTAGGAGCCAAATTGGAATTTGATCCTCGCATGCTCTCAAATTCCACAGTATAAACTGTGTAATGTCAAAGGTTAATCTATGCTAGCTACGGGAAACCAAACACGTTTCAGAAA
GCGAAATGAACAAAAGAGGACTTTGCAAAGCCAGGTCTACGACGGCAGCCTCTTACTACTGCTGAAAATAGGGTATAAGTTGCCCCGGTGCATGCTCTATTCCACAAGAAACGCAGAGTT
TCAGGTTTTCGAGTTGTCACTTGCTGGACCACCGAGAAATTAGCTCATCACGTTGGGAATCAGTACACAGCAACAATATGAAGGTACGTACACATATAATCCTTCTCATAGCTAGCCCTT
GTTTCTGTGTTCAACTGAGAGCCTGAGACATGTAAACTTTATGCCTTTTTTTCAGCAAAAGATTGTGATCAAGGTGCACATGACGTGCGACAACTGCCGGAGAAATGATCTAGCTTTAGC
AGGCTCGACGTGCGGTGAGTACTGCCTACTACGTACTTGAAACACGTACACTGTGCTGCGCCAAGCATATGCGCAACTGATGAACTGACAATATCGATGTGGTTGCAGGGGTGCAATCCG
TGGCGATCGAGGCGGCGGAGCGCGACCAGCTGGTGGTGGCCAGCGACGGCGTGGACGCCGCCAGCCTGGCGAGCCGCCTGCGGAAGGCGGTGAAGGTGGGCAGGGCGGACATCATCAAGG
TGGAGGCGGTCGTCCACGGGAAGAAGGCGGCGGCGACGAAGCCACCGGGCCAGGCAGCAGCCGTCGCCGCCGGTAGTAGTAACCCCTACTACCCTGGCTATGGCTGTTACTGCCCCCGGA
ATGGCACCATCTACCCGTACGCCGCCGGCCACTGCTACGTCGAAGACTCCGACGAGGGTTCGTGGTGCACCATCATGTAGGCGCACGGATCGAGATTTCGAGTTGGCGATGGCAAACATA
TACAAGCATTTTGATCGATCTCCGGATGACCTTCTCAAGTGCAAACGTGCAGTAGTACTTTATGGCTGAGAATAAACATAGGGAAAATCATATACGTATGCATTTCATGTTTAAGCAGGC
GTTTGGAGTTGTACAGGTTTGTTTGATTCCGAATTAGCTTGGTATTCGTCAATTTGGGAGGGATGATGGGCCTTCTATCTTGTTTAAGGCCCATGCATGTTTTACAGAAATGAAAGAGCA
TCTTAAATGAGGGGGCTTCCTAGTCTCATGCGCTTTCAGCGCGTAGCATTTACACGGTTTCGTCAAAAAAAAAAAAGACCCACGGTTGCACACCCACTCGGGCTCGGCTATGTGAAGAAA
GGGAAATGTGAACTTGGGTTACAAAAGGTAAATAAAATTTGGATTTGGATTACGAAACTTAAAATGTGAATTGAGTCTCTCTAATCCGTGGAATCCGCTTCCCTATGGATGCAAGTGGGT
TTCGTTCCACTTTTTTTTTCCTTTGAAATCCGGATCAAGTCACTTGCATTACATCCCTACTACAATTTCCAAAACAGATCACACAGTATTCACTGAACCTCAATACATATGTTGTTCATT
CGGATTGGGATTGCAATAACCTCTGATACTTGTTAATCTATAAAGATTTTTTCCCTCGCAAAAATAAAATACACCGCTAACTAGATTCTACTTCCAATCAGGAGGCACCGCGTGGTGCAA
TAAGAGGTGGTGGGCCCATACGTCCACGGTCCACGGAAGGATCGTGCGCGACTGATTTGCGTGCCGCTAGGAGGAAGAGAAGTATCGCGCTGGACACAAGCCAGAGAAGGCTGATGGTTG
GATGGCAACGCACATGCACTCGATCGATGCTACTCTGCAACTGCAGCCAACAGCTTTGGTCATGCACGACTAGAGCGGAGTCAATCGAGTCAACTGAAGGTGTACAGTTGTTTTCAAAGA
AACAGAAATGATAGGATTCAAATTATTTAATTATTTCTTCAATAAGAAAAATCCTCATTGGATATGACGGCAAGTACCCACCACAAAATGCTTTATTGTTCCATGCGAGTCAATGGTACN
NNNNNNNNNNNNNNNNNNNNCAGGTATGTGGTACTAATAGTATCGCTTTCACACTCTATTAATAACTACATTGATGTCCACAGTTTTTCCCACGTGCGTGGACTCCACCATATTTTTGTC
TCTTTCGTAGTCTTGTTTCTTCCTCCTATTCATAGTTTCCCTTCCGTTTCTCTCTCTTCTCCCACCTCTCTCAATCAACGCTCATGTGGGGTGAACATCCCACCTCTCTCAATCAACGCT
CATGTGGGGTGAACAGAGCCCACAACACAGCATGACTAGAGAGAAGAAATCAAGTCAACTGAGTCAACTCATAATAATCATATGCATTGTTATTTTTTAATAAACGAATTGATGGAACTT
AAAAATTTATTGTAATTCTTAAATGAGAAAATGTCCATCCAAAATGCTGTAAAATTCCTTTACTTCAAATGAGAGCTCAATTGTAGTTCCCTTTCAGCCCATCTCCACCTGTTCAATGAT
CCGTGCGGCTAGGTGTCGACTTTGCATCGCAAATAACATGGAAATATACTAATTTGTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGTTCATAGAATACTAAACTAAATTTATATGCTAATTAATACCGCATACTGATGG
AGGAGGTAAGCTCACCATTATGGAGGTAAGGTGGCCATATACAGATGCACCAATCCCCCCATCCAAAATAAGGGATGGCCCTCCAAATAAACAAACAAAATAGGGACCATCATATCTACC
TAATTGAACTGAAACATGGACCATTCCGTCCATTTGACTACGCTTCTACGCCCCTCCCGAAACACATGATAAATTTCATCGTAGTGTTTTGTGCGAACACGCATGGGTCAAGGAGATTAA
TTCATATAGATGGGACCATCCCATCCCACTTCGCATTTGCACCCCCAAACCGAACACGCAAAAAAATTCACGCCAAGCTCAAACCAAATATATGATCGATAAATTCTACGTGTGGCGGGT
TTGTACGAATGCACATGGGTCAAGGAGCGGTATGAATATACAGGAATACGCATGTGCGAGCGGTCAGCCTCGTGTCGCCGGAGAAAGGATCAAAAGCAGTAGGGTCCCTTTTTCGTACGT
TCCTCGCGGCCGTGCGATGCAGACCAGACGGGCGACACGAAAGATACCACTGATCCAAACAATGTGCAGCTTGCATAGACAGTGCGCTTACCGTGTGTCGAGGCAGCTTATGGCCCGAGC
CTTTTTTCCCAGCACTTGTCGCATCTCATCTCTATGCACCCTGATCCCTATCCTTTGCTGAAAAATAAGCAGTTCGAGACAGGAACACCACGGCAAGATTCGTGACTTTTGCCTAGAGTT
TCAATCGAGTGGCCGACGGTTGATTAGTCATTTCACCCGCTAGTAGGCATTCCGTCCTAAGTTCTTGGTCGCTACTAGTCACTGACTCCAGCTTGTTCTCTANNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
TATATCCAAAGATGCATGTGGGCATTACGTATCAACAAATACAAGACCAAACTCATCTAACTAAATCAACGATCACACCAACATCAACAAAAGGAGCCTTGAGAAATCAGCACATTTTTA
CCTTTTTTTCCTATTAATTACATTTCCATGCATTCTGTGGAGTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTAATAATGGAATGAGTATGGAATGAGTAGAACATGCGGATGAACGGA
CCTCGGCCAGTTGATGGCGACAGCTTTCGCATCTCCCCCCGCTCTATATAAGAGCGCGTCGGCCCGAGCAAAGCTTCACACAAGAAGCGCTAGCTCGATCAGTTGGTAGCCACCCACCCA
ATTCTCCTCGGCTGATAGACTGTGATCTGTCGATCGCGGCCGTAGTTCGGGCAAGCTTCTCGTCGATCACCGTCGGGAGGCAATGAAGGTAGGGCCTCGTAATTCCGGTGACCTCGCTCT
TCTTGATCAGCTTCGTCATCTTCAGAGAGATCTGAAACTGGATCATCATGTAACTGACCATCGCTTTGATCTCTTGCTTGTTGCTTCTGCTTCTGCTTCGTCGTCTGCCGGGTGGGTGCA
GAAAAAGATCGTGATCAAGGTGTGCATGCCGTGCGAAAGGTGCCGGACCAAGGCCTTGAAGGTAGTCGCCAGAGCCGACGGTACGCGTGCATTCAATTCTTATACCTGCCAAAAAGCTGC
CACATCTTCTGATCCCCTACATACTGCGCCTGTTGGCAGGTGCTAACTAACAGTTCCCGTACGTGTGTGTAATTGTGTACGCAGGGCTGATCTCAGTGGCTATCACCGGCGACGAGAAGC
TGGAGGTGGTCGGCGACGGCGTCGACCCAGTCTGCCTGGTCAGGTGCCTGCGCAAGAAGATCTGCTACGCCGAGATCCTGCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCGTGGTGGTGCACGCGCTGCCGCAGAGCTGCCCCGGCTACTGCTCCTGCCACCGCTGCCACCCGCCGTCGCTGATGGTCTGCGAGG
ACGATCGCAACAGTTGTGCCATCATGTAAAACTGTTAGTTGGGTAACGAGAAGTGGCATCTTTAGTTTGAGGTTTCACTTGGTCCATCTTAGCTTGCACAAAACGAGAAAAGTGAAAGTG
AAAAAAAGGAACTAGTATGTTCCCAGTGCTTGTATGTGAGGCACCGGGCACGCCTTAATAAGTACCTCTAGTCTGATCTAAACTATATGAACGTGTGCTACAGTTGATTCTTAACAAAAG
CACTTAAAGAACTGTGTAAACATGGGAAGTTTAGTAGCAGTATTTCGCATGTCGACTAGAATTAACCTCTGCCGTCTTGCATAAATAGTTGCATGCTTTGGAATTTTTTTTTATCTTAAA
CCCTTTTTAAAGATATTTTTCAAAATAACCCCTTCCCAACTTTATTTCTACGGCGTGACCCTTTTGGTCGCGCCGTGCGTTGTGGTGCGGCAGTTAGCCAGCGTCACCACGCTGGCGCGG
CTTGCCTAGCCGCGACTGGGTGAGGCACTACCGCGCCACATGCGCTTGATAGGAACACTCAAGCTCCAGTAACAAAATGAGGGGATGGAAATATGGAAGTGTGGTGGTGGTTGGATTGGA
TAAAAGTATAATCACTTGAGATCACTCAACAAGATCAACTAGCATCGAAGATTACTCGATGGGTTTCTCAAATAGGATAACTCGGAGGTTACTCGACGAGATCAACTAGCATTGGAGGTT
ACTCTACGGGTATCACAAGGAAGAGCAACGCTCAATTCTCAAATCATATCAAATTCATCAACTCCCCGACAGATTACATATCATCCCTTTATATAAAGAGTGAGAGACACACACACACTA
AATACTTGAACTCTTAGGAAAACTAATGGGCACTTAGGAAAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
TGGTGATGATCTGAGATCATACATACTTACCGTGATGGTCCAAGTACGTATCGACGAACGAGTTTCATGAACCATGACCAACTGTCGTTGTTCTCACTCTCGGCCAAGGGAAAAGCTAGA
GGCACAAGCTGTTATTATGGATCTACAGCAACAACCATCATTAGTGTACCCTTATACTTCTCGGTCAAGAATGTAGCGTCAACAAGTATCACAGGACGACAATGTTGGAAAGACACACGA
CATTGTGGGAAGCAACAAAAAACCATTTGGAGGACGTGCTTAAAAACACCATTATTAGGTTGCATCATGCCGGACGTGTGAGGGAACTATTTTATTCCGGGATTGTAGTAGGCCATAGTG
GTGAGGACCCTAGGAACCATGCCATATGACTTCGTCCAGTCTCCCCAAAGTAGTGCAACGGCGTGTTGTTTTGCCCGCCATGCCTTTAAATACTTGACACGATATCCACTAAAGGCAAAT
ATGGACTCCATGAGAGATGGTACTGATATCTCACTGTCGGCACGGATAATGCCTAGGATGCGCCGCCCAAGATACGTAGCTGTGCACTGGGCGTGCACTCGCTTTGGCTGAGAAGAACCG
CAAGTATGAGGTTGCACAACTTTTGAAATCCTCCATTGTCCTGTGCTTCTAATTAGGTGCGACCATACATGCCACATGCATCCTTGCTTGCACATGACATTATACCTTAGGTTCTTGTCA
GAGTGAACTATACTGAAAGGCTTATATAACCTCACTGCGTAGTCAGCCAAGAAAAACTTGAGCTCCTCAAGACTGTTGAACTTCATTCCCTTCTTAATCACTGGATTCTCACTATAGGGT
ATCACTTCCAAATTCACCATAGTAGATTCACATATGGCTTTGTAAACCATGCTTATGTCCTTAGCATTAGGAACGGATGGGAGTTCGATATGACATTCCTTCAACAACTGCAACTCATTA
AGGGTGTAATCAAAACATTGATCCACACAACCAATATCCTCTACATCATGCACGGTTGTAGTGTTGACCTACGGCCCATCCTCCTCAGATTGTGACTCCTCCTCCCATTCAGACCCATCT
CCGACTACTGCATCTTCATGTGCGTTGGCGTAAACATCTTCTACCCCATACTCCTCCTCAAAGTCATCATCTTCGGAACCTAGAGATATGTCATCATCATATATGTTTGCTTCTTCCCAC
TCAAAAGTATCATTGGAAAAATCACAATTCGCAATGGCCAAACCAAAATCAGATTGGCTTTCACCTAAACTATGATGTGAAATTGTTGACTCTTGGGTACCATTCTCAACCACTAACCGA
ACTTCATCTCTTAAGGCAACATTTGCGCTAGGTCTAGGACAAATATCAACTACCACCTCCAAACATACAACATTTGCATGCTCAACTACCTCCTTATATTGCTTCCAATTAAACTCGGAT
GGCAAGTTCATAAGAACATAATGAGGTCTAGCTTTCCCACGATCAAAACAGCCTCTCAATGTCATCTCATCTACTCCACATCCATACTTTCTCATTGCACGGTCAATTAAATCTTTAAAA
CTTGGACAAGCATCGAACAATTCCACTACCTCATTCATATTCTCAAACTCCCCATTCTCTTTCACAATCCCACCATGAAACAAATGAACTAAACAATCCATCTACAAAATACAAAATATA
GCTCATTTCCTATGAAAAAAAACAATAAACTACATCAATTATACAAATAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAATAAA
CCTACGCATGCTATGTACACTACACCAATACATCAACAACTATATAAATCAATGCATGCAACTACTTCTACATGTTAAAATCGTTGGCAGAGCTGACTGCGTATGAACTAAGCATCCATT
ACTACATAACAAACTTATAAATCATAAAAATTTCTAAACAAAATTCTAAACCTAGTTCACCTAAACACTCTCCGATCTACTAAAGGGAACGGTAAAAGAAGAAAAATAGTGGGGGATACC
TTCCCAACGACGCGGGGATTGATTCCTCCCACTTTTCCCACCCCGAATCGTTAGATTTGGGGAGATTTTTTTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCTAGCGCGGCTATCAAGTGTTGGCGCTGCCGTGCCGGGCGGTCTGCCGCGACAAGCCTATCCTGCAATGTATGTGGCGCGGCAGCGCCT
CACCCAGTCAACGCCGCTGTGGCGCGGCAGCAGCCGCGGCTAACCGCCGCGCCACGGTGTACGGCACGACCAAAAGGGTCACGTCATGCAAATAAAGTTGGGGAGAGGNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCATGCTTTGCATGTCGTTATACTCTTCTTGTTTGCATTGAGAACAGGAACACCCATGAGGCTAGGTAAAGCACATGACTGGCCGATTTG
GCACCCAGCTCCGAAGCCAATCGCCGTCCTTCTCTCCCTGACGAACGCAGAACGGCCGTCACCGTCATCCCAGCCGAACTGCGCACCTGTGCTAATCGCCCGTCGCTGACTCGCTGCTAG
GGTCTCGATAGCCTGTCATAGCACTCCGCCGGTAGCCGAGATAGGCCGGGTTTGGCCGTCGTCCGGCCATGTCACCTTAGTTAGCTTCACCACCTGTCTTCTCATGCAAAATCAGAGCCA
GAAGTTTATTTGCATGCATTATATATGTCCCAAATATTCTTTTTTTACTAATGGAGGGTTAATTAATCTCCATCCTGTGTGTGTCAAATTTCTTGCTTAACTGGGAAGCCTGCGATTGCA
CATGTGATTTATTCGGGGTTGCTTCCGTGTGCCGCCGCTCTGTGATTACAGTGTAACCGGATCATTGCAGCAAGTGTTTTGGCGTGCAAAATGCCAGCATGAAGAGATCAGAATGCTGAC
GTCACGCTGATCATCATACTGTCTCGGTGTACGCTGCCATGGATAAGGATCGTCATTATTTGTGTGTTTGGCCATGTAATGCCGGTAATAAAAGCACATTGCGGTTAAAAGGAATTTTAA
CTGATAGTGGTTTCTTAAGATGCGCGCGGACGCGGTGAGAAGCAGCTTGATAGATCAAGGAAAAAAAAGTCCATAATCAACAGTAAAATACACCGACGATTCCTGAATTTATTTTGTGGT
ATCATCCGGGTCCCCAAACTCTCAAAATACATTTTCAAGTCTTCAAATTTGTCTCAACGTGTCACCTGGATCCCTAAACTCTCAACGTGCAGGGTCCATAAACTCTCAAAATACATTTTC
AAATCCTAAAACTTGTCACCTGCCGCTGATGGCAATACTTCCTTCTTGCTCGTTGCCTTCACAACCACCTTATGCTAGTGATCAGTGGCGAAGCTAGAGCAAATTGGAGGGGGTGCACTT
ACCTTGTGGGTGCATAAAGTTGAGTTGTGAGGGGTGCATATATGATGAAAATTTGTAACTAATCACTTTTTTAACTTTTTGGGGGTGCATTAGAACCCCTAATGATAATATACCTTCGCC
CTGCTAGTGATCACGCANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCT
CGTCCGGTTGGATTGGGACATCAACGCGGGTAGCCACTGAACTCAAAAACTGCCACACCCTAGTGATCACGCATGTGTTGCTTGGCGTTTGATTGAAAGATCTTAAAATGCACTTTGAGA
GTTTAAGGACTTGGATGACACCCTAAGACAAATTGGGGATCTGATAATGTGTTTTGAGAGTTTAGGGACCCATATGGCATCTTGAGACAAGTTCATGAAACTAAAAATGCATTTTGGGAG
TTTAGGGATCGAGATAACACCTCATGCAGCAGTTCACCCGTCCTTCAAATGGATCTGGAAGTCCTCTTGTCAGCATAAACANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTCTGTTCCTTTAAAAAAAGAGATAACACCTCGTGCCAAGTTTACGAACC
GTCCGTGTATTTTACTCATAGATCAATTATGCGGTGGTTGCCACGGAATGAATGACTTCCGTTCCCTGCTAGATAGATAGCCATCTTACAATCTCGTGTTGGTCTGTTGGTCCACACGAT
CTATGGCAGTCCACAAGTGATCAATCAGATTCCAGTTACTACCTTCATCACCCGAGTTGGAGGAGCCCCCACCTGAGTGCAGATCTCGGGGCGGCTCCGGGAAATGAAAAATCTGAGTGT
GGATGGCACCTGAAATGCTAAATCATGAGTAAGCTTTACCGTTTGAATCACGAAACTAAACCGAGCTCTAGTCCTTGGAATTCATTTTTCCAGATAGGTGGAACTATTCTTACTGTTTTT
TAGGAACACGCAATTGATACTCACCGAACCACAATAAGCCGTTCTTTCAAACCTTTTTTCCCATAACGCTTCGAACGACACAAGAAGAACTGCTATGTCGTAAGCAATATAATCATGCCA
TGGCGCCTACCGTCGCTGTCACGCAGGCATCACCTTCGTCTGAGATCTAGAAAGAAGGGATCCTATTGGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGGTTAGTTGAAGTGAAC
CAACGATTGGACACGGAGAAATCATGGATAGATGAAGTGAATTAACGATTCGATGGAGAAAATTAAACGTCTGAGATTGTTCAGCTGATCCGTCACTCAACGCCAGCAACTTGCATGTGT
TTTACATTTTCCGGATCAACTTGTCGCCAAGTAGATTGTTCAGCTGATCCGTCGACTCAACGCCAGCAACTTGCATCCTCCTCCACTAGAAATCCTCTCTTGTCCCCCCAGAACAACCCA
CACTCTCCTCGCTTCTTCAGTATATGGTGAGCGTAACCGCCGTGACAGCGATCCGCGGCACTACTATTCTAATTTCTAACACCGAGTCCCTGCGTGCCAAGTTCCGGGGGAGCAAAGTCG
CCAACCGCACCGGCCGCAACGGAAATTTCCAGCCCATTCTCCCATTGAAATCAGTTAATTGCCAGGACACACCGACCGAGACCCCCAGCAACCTTCAATCACGCGTCGCCATGACGGCAA
CAACTACCCATCGTGCATACGCATACGCTAGGAATTAGGCTTAGGCCGGGTGACAGACCACCAAGCCTAATAAGACACTACCTGCTCCTAGCAGCATACTGTATTATCGAGCTAGGATGG
GATCGAGCTCACCTCTCAGGTCTTCCTAGTCAAGTCATTGTGTCGCAGTCGGGGCTCTGCGGGCCTTAAGGGATAAAATATCCTTCAGCAGCTGAAGTGCGACGACTTGACTAATTAATC
AAGTCAACTGGCGGTAATTCGCCTGCTAATTAATTGCGTTTGCGTGTATAAAAAGGGAGGTGCCAGTAGTGTGCACACTACTGTTAGGCCAAGGCAAAGCCTCTTTGCTCAAGGTTGAAG
AAAAGAGCTAGCAGTGTGCTTAGCTTTGTAGGATCTTGCTTTGTGTTGCCTATCATATAGCTCGCCTGAGTTGTTGGCTTGTCAGAAGAAATGAGGGTGAGAGATCCTGCTAGTTCAGAT
CTTGTACTTGGATTCTGCCCTTTCTAGCTATCATTATCTCTCTGCACATGTCCTGTGATCAACCACTATAAAACTTTCCTGTTTTTTTCTCCCAACGTTTTTTGATCGTTCGAAATTAAC
ATTATTTGCAGAAGGAGATGATAATCAGGTTGCAGACGACCTCTGAGAAGGGCCACTGCAAAGCTATCAAGGTGGCTGCTGCAATCTCAGGTAAACAAACATACCTTGAAGTCTTTGATA
CATCGATCCCTTAATCGCCTAGCTAGGTCTCTTCTATTCTCATCAGAGGAAATAAAAGTTTCTATATAGTACTATTTGTCCTAGTGGTGACGTGTGCTTTGAATCGTTAATTCATCGAGC
AGGGGTGGAGTCCGTGACGATCGCCGGCGAGGACAAGAACCTGCTGCTGGTGATCGGCGTCGGGGTCGACTCCAACCGCATCACCGAGAAGCTGCGCCGCAAGGTGGGCCACGCGGAGGT
GGTCGAGCTGCGCACCGTCGACGCCGCCGACGAGCTCGGCGGCCTCGCCGCCGCCGAGCACGCGTACCGCTACCACCCGAGCCCGAGCCCCTACAAGTACGCGGCGGCCGCGCGCGACCA
CCACTACTACGCCGCCGGCAGGGCGGACCACCGCTACTACACCGGCGGCGGCGGCGGCGGGTCGGCGTACGCGCCGCAGATAATGACCCCGCGGGCCGACTACCACTACGGCGGCGGCGG
AGGGTACCCGGCGGCGCAGTACCAGCAGCAGCACGACTACTTCTACCACCCGGCGGCGGCCGCCAACACGCACACGGTGGTGCACCACGAGTACGCGAGCGACCCCAACAGCTGCTCCGT
CATGTGAGGCGTTAGTTGCCCGGATGCTGCGTGTTTCCCGTGATCTGGGAAAGAACTTCCTGTTGCAAACCATCCGTTGTCGTCGTCAGTTGGTGCGGTGACCCGGTGTTACAGTCACAT
GCAGACACTACGCTAGCTACTTCCTGATTCCGTGTAATTAGTGTACAGCAAGAAGTACAGGCGTGGCTGCGTGAACCTGTGTGTGTACGTACTCCAGCTACAAGCTTTCCTACTACGGCG
CCAAGTGCAAGCTTGTTTGGAACAAAGGGACATGGCTAGGACATGTGTGCAATCTCTAGCTCAGGAGCAAAGTTGAATAGCTGATGAGTGTCATGTTGGTCTCTTAGAGATCATGCTTGT
GGTTGAATAATGCTGCTTGCAGACCAAACTTTCAAATGCGAATTTCAACTTTTTTAAAAAAAATTCAATCTAATTTTATCTTTGCGATGTGAAGTTTCTGCTACGTATTTGAAAACCTGC
TGAAATTAAAATCGACACCACGAATTGAGCACAGCTCGGTTTTGTTATGTTTCTGGTGGTGAAATTGAATCTATCCGCCCAGTTCCGAGTTCTTAATTTAGCACAAATGCTCACATTTTT
TTCTACGGGATCCCCCTAAACACATCACTTTCAACTCCACGCATACGATTGATCCTGTTTTTCTTACTAGTTCCCAGTGTAGAAATATTTCACTGGAATATTCCTTGTGTTAATTAGCAA
ACATTTCAGGTTGGTAAAGGTCAATAGTCACTTCTCGGTTACTATTAAAAATAAGAAAAATAAATACTAAGATATATAAGATGAGGCATGCAGCAGTACAATATACTACAATATACCTCT
TAGTTGATTCCTGTCCTTTTTCTGATAAAAATTGTGATCGCAAGAGCTGCCTAATCACAAAAGTAAGCTCTAGCATCTCCAACTTTGCTATCCCCTGTCCTTTCCGATGCAAGGTTTTCC
TTTCATGTTATCCGGATCTGACTGCATGCATCCACTGATCCTACGCCGTCTTTCGTGCTCGTGTAGGATAAGCACGCCTGCTCAGTTAGCGGAACCAACCACAGGTTCCCAAGTCAATTC
TTCCGCGCACTCAAACCGTGTTCTCGAAATACAAATTCAAGCATCCTGACAACATCTACTCCTCTGCTAGTGGCATTTTTCTTTCCCTGCGCTACGCCTACGCGTATAGACGATGACGTG
CTCGTGGCGACGCCAACCTCTAGCGAGCTGCAGACGTCAGGCGTAGAGAAGTTTGGTCAGATTTGCGGCATCTACCTCGCAACTGCTCTAAGATTCTTCTCGGCCGTCATTCGTCAGAAT
CGTCGTGTCTCGCGTACTGAACAAAATAGGAGTAACAACAAACATGCCGTGACAGTCACTGACTGAATTTTGTATGTAAACGGTGGACATCTCAGTCATGGACAGATGGACTCCGGTCAT
GGTTACTTTTTACTTCGCTGGCAAGTGGAAGACAAAGTAAATGACGCAAAAAATTGATCTTGGACTGCAAATACTGGATTATCCTAGGGTCTTTTCTGCATATACCGAAGGCAAGTTTGT
CCTTAGTTCGTGGTTGATGAAGATTAGCCAACTACTGAAACGACCACTCCAACCCTTGGATCATGACATCAACTCCAACCTTCGCCATTATTCATCGTGCTTAGTCGCAAAAGTGTAAGG
TCCTGTTTGGTTTTCCCTTACTTATCTTTATCTTTAGGGACTAAACTCCTCTTTAGTCAGGGACTAAAGTATAGTCTTCCTGTTTGGTTATAGTGACTAAAGGACATTAAATGAGATAAA
CAATGACCAACTTGCCCATGATCATTGTTGCCCCAGCCTTTTTCCTTCTCTGCCTCCCCACGCAGGCAAGCACAGCACANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTAGGGTGGGGG
TGGGGTGGCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAGTGTCCTCTT
GACCTGTGGAAAGAAAGTATGGTAGCGTTACTACTATGTGAGGCAAGTGCGGGTATAATTCATCTTGACGGGTCTTCGTACGCGCATGCATATTTGTCCTATGGGTTTCTTGTGCGGTGT
GGTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCCCTGAGGGCAAACCATAAGTTACTTTGCATAAAGCTGGACCATTTGGGATGGCATTGTT
TGACTCGGGGCACGTAAAGTCTGCGATGTCGAGTCGCCATCAACTTTTCCTGAAGTTCTGAACCGCCAATCCGCCATACCGGATTGCTGAAACTTTATTTAACCTCTGCTTAATTCTTTT
CAAATTTCAACCAAGAGTCGCCTGGAGCAGTTATGAGTTTACTAATCTAAAACAGTAAAAAAATTGCAACCATTAACGTCACGGAGAAAAAAAGAGATGGGAGCTGGGGTAGTATAGATC
AGTCTGACCAGTTTCCAGCGCACCTCCGTGAGAGGCAAAAACATTCCATCTTCCCTGAGCAACGACCAAATTGGCTTTATAATTGGGTTCCCATCGAACGGTGTTGCAGACTTACACTTG
CACAAGCATGAGGGTAAGAACTAATTTCTCCTCAAACTCTCTACTTCTGCTAATGCTCATGTTTAGCAACAACTTAACTAACACCTGAGTTATTGCCGAAATTTCTTCAGAAGGAGATAA
TCATTCGCATGCAGCCGGATTCCGACAAGGGCTGTAACAAGGCTCTGAAAGTGGCAGCTTCAGTCAGCGGTATGGTACCACATACCCATTGTCCTTCGTGAAACCGATCGAGTCCATCCG
AATTTCTTGGGCAATGACATGGAAGCGTACGTGACATTGGCCAGGGGTCGAGTCGGTGACGGTGACCGGAGCCGGAAAGGACCATCTGCTGGTGATCGGCGACTGCATGGACGCGGGCAA
GCTGACGAGGAAGCTGCAGAAGGAGGTCGGCGAGGCCGAGATCGTGGAGCTTCGGACTCTGCCTGGCCGTACAACCAGCGCCGTGTCCAAGGACGTCTTCTTCACGCTGTCCCCGTACCA
GCGGCACCCCACTCCCGGCCGGAGCGTGCCCGGAGGCGGCCGCATCGAGTGCCCGGTCGCCGCCTCCTCGCGGTGGCCTGGCAAGCATAGCAGGCATGGGGTCGGCTACTACCACCGCAC
CCCCAGCCCAGGATACTACCAGCACTGCGCGCCGTCGCCGTTGGCTGCTGGGCAAGGCAGCTACGGCTACGCGGGGGGCAGCGCCGGCGGCGGCAGCTTGTACGTGCGCGAGGTGGCGCG
CAGCCACCCCGCGAACTACTCCCCGATGATCGCGCGCCACGACCTGCGCGCCGTGGGCCACACGCCGCCGCGCGCGACGGCAGGCGGTGAGGGGCGAGAGCACGGCGGTGGCGGGCCCAA
CTGCTGCTCGATATTGTAGCGCGTTTTTTTTCTTCTGCCGTTTCGGCAGATCAAAGCTGCGTGTGTGCTCATGCCCAAGCTATTTGCAGGTTGTGTGCATGTATTGCCAACAAAAAGGAA
ACTTAATTTGCAGTTACATTTTTTCATTACTAGACGAAAATCGGAATCAACCAGGACGGGTGTGCTGCCAGTGCAAAAGAACCAACGCGTTGCCATTTGCCTGTCGTGGAACNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAGTTGACCGCCGTCTTGCGCACGCAGGCCTCCGGCCC
CCGCCCATCCTCGCATGCCTCCTCCGCTCCTCGTTGTCGACTCGGCACGGCGGCCACCGGTCGTATCCTCACAACCACCTGCGACCAAAATAGCAAAAAAAGGTAAAGCCAGCACTCGTC
AAGCTAGATCCATCGCCCCCAGCATCGGATCCCTGAAATCGCCCACGAAACCCTAACTGTACATGGACGCTGGANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCAAATAGCCTGCTCC
ACGAATTACCATTCCTTCGAAAAGTTGTAGACTCCGTCAAGCTGAGCTCCCTGTTCCCATCTCCGTACCATATCTTCTCCCCCATCTCCGCCGCTATAGACCATGCACGCGACGTTGTGC
CGCTCCGTCGCGCTCTTCCACCTCGCCTCCCTGTCCCGCCGCCAAGCAGCTCCAGGAGCGCCTCCCCCGCGCGTCGCCACGCCAAGCACCTCCTCTTCCACCTCACCTCCCTCCGCACCC
CTCTCCTCCGTCAGCGAGTCCGAGCACGGCGGCGTGCGCAGGCGCTGGGCGCGAGTGAGGAAGAGGTAGGGCCCGTGCCTCGACCTACTCGGAGTCTCGGAGTGGGTGCGCTAGCAGTCA
CAGGCATTCTATTGCCGGCGGGCCGGCCGGCCACGGCCAGCCGGCTGTTGTCCTTTTTCCCCTGGTGGACTTCGCCCACGCTTCCATCTTCCTCAATAGCTCGAAGGACAAGGCCACCGT
AAACATACCCATCGAGCCACCTGACAGCCTCCTCAGCATCCCGTCTCTGAACAAACCTGACAGTGCCGATCTGCCTGCGCGACCCATCCTTCTCACCAACTGCAAGCTGGACCCGGACGA
TAACGCCATACCGGCAGGAGAGGTTGTAGAGGTCACGCTCACGTGTTATTTCCTCCGGAAGATTGGTCACGCGGACAGAGATCTCGGCTTGCCGTATGCAGCTCGCGCAGATCGGAGGAG
GGACGTACGGCGCGGCCCACTCGACCCGGAGGACGAGGTTGCCGTATACATGCCCGTTGAGCAGGCCGATAGCCTCCTGCGCGGCCGGCGGCCGAAGGAACTCGACGACGCCACACCGCG
CGCGTGACCCGGCCGGCCTCCTCGTCACCGTCGCCGTCGTCCGGTGAGAGGGAGACGCGGGTGAGGACGCCGAACCGGCACAAGAGGTTGCGGAGGTCGGCCTCGCTGGTGGCCATCGGG
AGGTTGGCCACGCGGACGGCAGGGATCTCGTGGCTCCCGCGCCGCCGCCTTGGGTCAGCTCGGTCTCGTCGTCTGCAGGCCGGACAGACCCGAGGCGCCGTGCGGTCGACCGCGGGAGGA
GACCCGTCCGCGGATGCTGCTTTTATGAGGTCCCTGTAGAGGCACTCTGAGGTCGGGTGCTCGCCCTTCTTCGCGCAGGTTAAGCAAGCCATGAGAGCGGCGCCTGAGTTGCTTGCCATC
GGATCATCGGAATCGCTCCCTGAAGGGCGTGGGCGCTCGACGGGGATCTCTTCGGCGGAGCCCATTGCGAGAGTGAACGCCAGCAGCCCGGTAGAAGGAATAGCAACTCGAGATCGCCGT
CGCGCCGCTCGGTTGGTCGTTGTGTGCGCTAGGGTTTGGGTTGATCCAGAGAGAGCTACAATGAAACAGAGCGCATCAGGTTGGATTTGGGTCCAAGTCTATCGGCCTGGAAGCGGCACA
TGGCCCACGCACGCACATTTTTGGGCTCGGCCAATGAGGAGCAGCGCCAATTCTTCGGGTAGCCCGTTAGCTATATGGCTTCCATTGTTTAAAATTTGTGCGTACAATATGATTTGTTGG
ATACATCTCATCTCATGCTCCCTCAAACCGCGGCGGGCGTCTGACCTCCTGCATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNTGCCTATCCTCCTCCATCCTACTACTATTGCTGCATGTCTATGCGTGCGTTGGGCTTACGTTACCCAACTGTTGTGCTATTTGGTTGTCTACATGTAATTGGCTCCT
CGTGGGTTTTATAGCTATATGGTTTAAATCTATATTTCTGAAGAAAACACAAATTCGATTTGCTTCGGTCCTAAAAAACTCGTATGGAAGAAACTCCAGATGGAAATTCTACAGTTTCAA
GGGGCCCTCGATCTCGGAGCTCCAGGTAATCAAAAACATGCCCGTTGAGCCACCTGACGGCCACCTCAGCATCATCCCTCATATCAAACCCAACAACGCCGATCTGCCTGCGTGATCCAG
TAGTCTCCGCCTCATCAGCTGCAAGGTGGAAACTTGCGATAACGCCAAACGGGCAGCACAGGTTGTAGAGGTCGCGCTCGCTGGTGCGCTCCGAGAGGTTGGTCACGCGGACACAGGTCC
CGGACTCGTCGTCCTGTCGTAGGCAGCTCTCGCAGATCGGGGGAGGAACGAACGGCGCCGCCCACTCGACGCCGAGGATGAGGCCGCCGTAGACGTCCCCGTCGAGCCAGCCGATGGCTA
CCTCGGCGTAGTCGACCTGGTCGAGCTCGACGGTGCCGACCGGCCGCCCCCGTGATGATACGGCGGGGTCCTCCTCCTCGGCCGGCGGCGAGAGGGGGACGCGGTTGACGACGCCGAATG
GGCGAAGAGGCGGTAGAGGTCGCGCTCGCTGGTGCCGTCCGGGAGGTTGGTCACGCGGAGGGCGCTGTCGCCGTCCCAGCGCCGCCGGTCCGGGTCGGGGTAGTACCCGCACGCTGGGCA
GACTCGATACGCGCGGTTAGGTGCGGGAGGAGACCCGTCCTTGGAGGCTCGTGCGAGGAGATGCTTGTAGGGACAATCTGGGGCCGAGTGGTCGCCGTCTTTCTTCCCGCAGGTTGTGCA
GACGACCGTGGCGACGGCATCTGCCTTGTTGCTAGCCATCGGCGGCGGATCACCGGAACCAGAAGCACTTGGTTTGTCAGACTCGCGTGGGCGCTCGAGGGAGATCTCTGCTTTGTTGGT
GGAGCCCACGGTGAGAGTCGACGCGGTCCGGCAGAGCCACGAGAGGCGCGCGATGGAGGACCTGGCTGGAGAGGCAGGTCACGTCCAACACGGCGGAGAGGGGTAGAGGCGTAGAGCTAT
ACAGGAAGCAGAGCCTACTCCGTTTCCGTTACCGTATCGGATTTGACCGCAAGGGCAGCTTGCGTGAGCCGTAGGCCGTACGGCCCATACCAACTCTTGGGCTGGGCCTTGTAAACCTAG
AAAATTCACCGTTGGGAATAGAGAATTTCATTTCCATGAATTTTCATAAATTAAGGGCCTGTTTGGATAACATGTCCTAAATTTTACATGTCACATCAGATGNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATGTCAAGCCCTAAATTTTTATACGAGTACGAGTTCACAATAAAAAAACTTTTCTTTTATT
TATGCAATGCTGTATATATACTCCCCTTTTCGGTTCCGCTCCTCCTCTTGAAGTGGAGAGCGCATATGCAAGTCTAGAGAGTAGAGAGCTTGGTCAGTTTCTAACTATTNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNTAGCTTGCTTCAACCAAATACTGCTACAATGAGATCTGAAATTCAAAACGGAGCGAAGCAAGCTGGAGCTTGGACCAGGCCATTAACCCTT
TGCTAGTCCCAACCTAGCAGCGTGATGATTTGAAAATTGAAACGTACTACACGTCTACACGGATGCACCCATCAGTGTCCGAGCTTCCGGAGTCCCGACCGGCAGCGCCACTAATCAGCT
GCCGCTCGCTCCACTGTACACCGCATTCTCATCCACTGCTCCCGCACTCATTAAAATTGAAAGCCATATGCTGCCACTGCCAGCGCCCAGCGGACCTGCAACTGCAACATGCCGGATCTC
ACCGAGTCGACCGTTCTGGTTCGAAATCCCTCCCCAAACCCGGCATACCGAACGAAAAGGATACTCCAAAGCGGGATCAGAAAGTTGCAGCTCCGCGTTTGAATCCCGTCGGGCTCCGGA
CCGGAAAATAAATTACTCCACCACCCCCATCCATCTGGCGGCCCGCACGCACGTGAGTGCCCGGCCCAGACAGGCAGCGAGCCCACCGGCCTCTTCCCACGTGCAGCGAGCCCACCGGCC
GCCGTCGCTGCGCGCTGTTCGGCGCCCCGCAGCGGCCGCGCCCTATCTTTCAGCGCTGCGCAGCACGGCCAGGGCCACCAGCACGGGCTCGCTCAAACTTTANNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTAAACTCGCTGTTACTGTTACTGTCAGCTGGAG
TTAGCCGCTTAGCCCCCTGCGAGTTTGAAAATATCCCGAGGCGGCCCCTGGGGAGTGTCCGTTAAAAGAAGCCCCCAGCGCCCTCCCTCGGGGTCGGAGCTTTTCAAACGCCCCCTGGCT
CTGTGGAGTGCGGACCGGTCGTCCCTGCCGTTGCGCGTTGCCAGAGCGAGCGCGGAGACGAGCTGTGCGATCCTCGAGGCAAGGGGCGAGGTCAGGCGGTGCGACGAGGCGATCGACTTC
GGCACGGCCGCCGCTGGCGTGATGAGGGCCGCCGGAGCGCACGACGTGGGAATGGCGCTGCGCAAGGCCGAGGAAGCCGGTGAGTAAGCCCTGCCCGCCCGCGCCTGAGAAGGGGCGGGG
TGGTGTGGTGATCCATTAGCTTTCGCTTGTGTTAGTTCTGCTTCGATGCTTCATCCGTCGTGCTGCGCGTGCGGCGGCCGGGTGATCCGCGCTCGCGCCGCTGCGTGTTTCCGCGCGCGC
GCGCTTTCGGTGTTCCGGCGGCGGCGGCGCCGTCGGCGACTGCGGCGCTCGCTTGCCACTTTACCGGTAGTGGAGTGGAGAAGCTCGGTCGCGGCACGTCCACGGATGCGGCAAGCAAGT
GGATTAGTACCGCACGGGAGAGTAATTACTGTGCTCTGCTCATCGTACGCCTCTGCAATTAAACACACTGCCTCCCCCAAAGGCAAGCCACGCGTATGCAAGCATACAGGGGAAGTATGA
TCACCGAACCATTAATCTAGATCGCGTTTGATTAGTATGCTGCGTTCATTAAACACGCGACATTAATTATCTATCTCATCGGTGTGATCGGGATTCGGGAGTGGTTGCGATTTAATATTT
CAAATTTCGGTTACCGTTATTCACAATTCAAAAATAAATCTGCATTAGTGAGATCCAAATTCGCAACAACCTTTGTCTCTCGGCTACTCCTAATCTGTAACAAATGCGACCTCTCTGATC
TGTTGTTGCCGGTGCTGCCCAGCTTCACGGAGGTGCGAGGCGGCGCGATGGCTGCGGCAGATGGAGCCCGCGGCGGTGGAGACCCTGCCGGAGAGGCCGTCCGAGGAGGAGTTCTGCGTG
GCACTGCGCAACGGTCTCGTCCTCTGCAAAGTGCTCAACCGTGTCAATCCAGGCGCCGTCCCCAAGGTGCGTGTCATATTCACGTCAAATTTGGGGACAAAATGTCATTGCTTTTGTTTC
CGTTGCATGGAAATTGAAATACCACTGCAGCATGCCAATTCTTCGTTTTTCTTCTTCTTCTGTGGGTAGGTTGTGGAGAATCCTGTCGTCACGGTTCAGACATTCGATGGGCCTGCACAG
TCTGCGATCCAGTACTTTGAGAACATGAGGAACTTCCTTGTTGCAGTTAGTGCCATGAACCTGTTGACATTCGAAACTTCTGATATAGAGAAGGTAAGGTACATAGTTGATTTGCATTGA
CCACATTATTGCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTCGTAAAGTTCTTGGATTATTGTGGGCAGTTTGATTTGCTCAATTGTAAGGC
TTCGAGGATTAACTGAACTGTTTTGCACATTTGGAAGAAAATAAGTGCTGTTTCTCATTGAAAAATGTAGGCATTCTATTTTTAGTACCGGAGTCCATCTATAGGTTCGATATATCAATC
AAGAAAACCCCCATCTTGCAGTCTGCTAGGTCATAGTAGATGCAGAATGTTAGCTTACTAGATCAAATCTATGACTTACCTCACTGTGTTAAACTTGTCACATCTGAATTCCACCTACAA
CGCTGACAGGGAGGTTCGTCAATGAAAGTTGTCGACTGCATACTCTGCCTCAAGGGATACCACGAGTGGAAGCTCTCAGGTGGCATTGGTATATGGCAGTATGGTGGCATTGTGAAAATT
GCATCCTCATGCAAAAGGCACGCTTCACATTTAACCAGAGGTGGAGGCTCAGACCAACAAATGCTGGAATTCGTGCATCTTCTCTCTGAAGTCTCCCTTGAGGAATCAAGGGTCGAAGAA
GCTCAACATTCTCTTTTTCAACACTTTGTTCTTCGAGTTGTGAGGGCATTTCTTCTGGAATGGGGTGAAGCTGAAGATTTGCCTCTAGATGATATGGTAGGTGAGTTCTGCTCATTCGTT
TCTATTTGTTGTCCCTCTTAGTATTGTCTGACTGATGCTGAACCACAATAACATTTGGACTCATTTTCATATGCTTGTGAATATCGCAGGTCATCGAAACAGTACTCGAGCAAGCTTGTA
AAGAATTTACCATTCTGCTTGCTTCCCATAGAAATCAGGTACTACTGTCGGTAAAAATTAGAATATTGGATTTCCGTTCCTCTCATTTTGATGTAACCTCTATGCCATAACCTTGCCATA
TATATGTTCTTGGAAAAAAGCATTGGCAAAATTTAAAAATAACGCTGTTACTGGCAGCCTTAAAACCTTAAATTTCCACAATAATAATTATTACTTACTTCAAGGCATCATCTCTAACAG
GTCAGGTCACTTCTAAGGAAGATGATGAAGGATGACAATGGAACTCTTTCTAAATCGGATTTGATTGAAGCTATTTCAAAATGTCTGAAGGAGAATAATCAGTGCTTGTTTTCTTCAACA
CGAAATCCTCGTGGCAGCCGTGAACACTTGAATGATGGGGGAGTACTTGAAAGCCAACAAGAAGAACTGGAGGTAAATACCATGCCAAAGTTAATTGTGCTAGTGAGCTTGTTACTTGGT
ATTATATCCCATGCAGAATCAGAATTGTTAATTAATACCTTTATTATCTAGGCTGCATGCTTCATGCTAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGCCCTAAGCTTAAATTGTAGAAATTCCAAGTTTTACTTGTCAGAACCCCTTTTGTACTTCCAATCAAA
TGTCTTTTGCGTGTTCTAGAAAAATGGACACCTTTTCTAGCTAAAGTTATGTGACTACAGTAATTGTAAAATCCTTTCTGTATTATGTGCTCTGTTGCATAGTACTAATTATGGTTAATC
TATTGATATTTGAAAATTCAGATGTTAAAGACGTCCTTCAATGAGATGAAGCTTCAAGTTGAATCTACTCGCACTGACTGGGAGAAAGACTTGAGGAGGCTAGGTAGGTACTAAATGTGG
AATTGTATCCAACAGTTTAACATTTAATTGCTTCATCTCTGAGCAATATCTAAAAAATGTAGAAAGCTACTTTGAGGCTCAGAACCATAATGCTTACCACAAGTTGCTGGAGGAAAATCG
TAAGCTGTATAATCAGGTCCAAGATCTTAAAGGTAACCTGCGAATTTCAATTTATTAATTTCATTTTACTAGCACGTATAAGATACGTTTGGTTACTGATTAAACCAAAAAAAATGTGTC
AGGTAGCATTAGAGTTTACTGCAGAGTGAAACCATTCCCAAAGTCACAATCTGATCAAAGGTCTACTGTTGATCATATTGGGGAAAATGGAGAAATCATGATTGCGAATCCTCAAAAGCA
AGGGAAGGATGGACGGAAAGTATTCACATTCAACAAAATATTTGGGCCTAATGCTTCACAATGTAGATAATCAATCTTCATCAGTTTTCATTTCTCCTTTACTTTAGAAACAGTGATTGC
CTACTCTAATGTTTATGACCTTAAATTTAATTTCTTTGTAACAGCTGAAGTTTTTGCTGATACCCAACCATTGATTAGATCCATCATGGATGGCTTCAATGTCTGCATATTTGCATACGG
TCAAACGGGATCTGGGAAAACTTACACAATGGTAATTCTTTGCAAGGAAAATTTTCTTAGAACTTCACAAGTAATTTTGCTTTGAACTCCGATGTTTGTGTGGAAAGTTCGAATCAGGGG
CACAATAGTATAACAGGAGAGTAGTTATTATTGGATAGATACCTAAGAACATTATCTTATTAGAAGATTTTTTATCTGCATGCCATCACGTTTATTGCTTTTCCTTATGATAATTTATTT
TGTATGTGCTACTCAGAGCGGTCCAGACGTAACAACAGAGGAAACCTGGGGTGTGAACTACCGGTCATTGAACGATCTGTTTGAAATTTCTCAAACCAGAGCAGATTCTATCACATATGA
TGTTAAAGTTCAGATGATTGAAATATACAATGAACAAGTGAGGGATTTGTTAATGACTGATGGTGCAAACAGAAGATATCCTTTTACATGATGAATAAGTTATATTTATTTTTGAATAAA
GATAATATGAATAAAGTTGAAATCTTCCCTCCATTAATTAAATACATTAATGTAATAGCTTTCTTCACCTTTTTTGCTTTACTGTCAAAGGTTTGTTTTTCATACGTTTTTCTTCTATAT
TTCCTTAACTATGAAACACATTAGAGATACGCAATAATTCCCATGTAAATGGACTCAACATCCCAGATGCAAATATTGTACCAGTTAAGTGTGCACGAGATGTTTTGGATCTGATGAAAG
TTGGCCAGAGAAACCGAGCGGTTGGATCAACTGCTCTCAATGAACGAAGTAGCCGCTCACACAGGTATTCTTGAACTCATGCATTGTACTTCGTTGCATAATAGGATCATATAACAAGTA
TAGTCTCTTCAATTGATTTATCTGGATGATACTAGTGTCACTGTACTGTTGGTAACTGTATTGCTCTTGTTTAGTGTGTTGACAGTTCATGTACAAGGAAAGGAGGTAATTTCAGGCTCA
ACTCTAAGAGGGTGCCTTCATCTGGTGGATCTCGCGGGAAGTGAGAGGGTAGACAAATCTGAAGCAACTGGAGAAAGACTAACTGAAGCCAAGCACATAAACAAATCGTTATCTGCACTT
GGTGATGTTATAGCTGCGCTTGCCCAAAAGAGTTCCCATGTTCCGTACAGAAATAGCAAGTTAACACAAGTGCTGCAGGATGCCTTAGGTACTAGAAGCCCTTAATCTTGAAGTCTTTTT
TCCGTCAAAATACTTCTCTAACCTTTTGTTTTCTGGCAATACAGGTGGCCAGGCAAAAACATTGATGTTTGTGCATGTAAACCCTGAAACAGACTCTTTTATTGAAACAATGAGCACTCT
CAAATTCGCTGAGCGAGTAGCCACAATAGAACTTGGTGCAGCCCGTGCTAATAAGGAAGTCGGCCAGGTCAAAGACCTAAAGGAAGAGGTATGGTGCTGTTTTAGAATTACTATACATGC
ACATACTTTTGGAACTTTGATTTCATAACTCATGGTATGAGAATTGTCTGACAGATTGCCAAGCTGAAATTGGCATTAGATGAAAAGGAACGTGAAGCAGCGCAGTTTAAAGATCTTGCT
AACCGTGTGACCTCTGAGGTGAGAAATGCAAGAACAAGGTCACCTTTAACTACCAGCATGTCCTTGAAACCTGAAGCTGGTCGAGAATCTAGTGTAGACACTTGTACAAGTGAGGTACTT
TGTTTTTCTGAATATTCTTATGTTCGTTTGTCACTGCAGTATTCTTCCAGGTTCTTTCAAGTTGCAGCACACTGCTCTCACATCTTTTTCTCTCAAAAAAACACTGCTCTCACATCTTTT
TTTCATGTAAGCATCCTAAAGATATGGCTTGATTCATTGACAGATAAGAAGCTCATCATCTGGCAAGCAGAGAAGGTTCCGCTCCCCATTGTCAGCGAGAGAGGTAGATGATAAATCTCC
TGTCATCAGCAGGGAGTTATACTTGAGCGCGCGGAAGTATAAGACTCCATCTCCTCCAGTGAGAAGTTCATTGTCTGCTGAGAGAGGCAGTTTTGCCAAAACTATGGAGAACACTGGAAG
CATCGATTGCACACCCATATCAAAGGTCGAAGTGCCTCCAAAAGTACTGTCCAGCAGCTCCAGGAACACACCTTCATCCGTACTGACAGCTCAGAGTCTACGGAAATTCCGGGACTCGGA
AGAGAACAGATGCAAAATCCCCTCTGTCCGGCAAAGTATGACAAAGAACAGGTCGGACAGCACGGCAAAGGCTCACAAAGAAGAGCTTTCGGCAAACAGACACTCGGGTACCAAAGTGAG
GTCAGAGGCCAAGAACAGGGACTCGTCTGAGATTGAAAACGAGTTTGCAGGCGATGAGCCAACCTTCCACTTTAACCGTAAGGCAAAGAAGCTCCCAACGCAGGCAACGAGACAATCCCA
GAACATTGATCTTCGGTATGGCTCAAGCTCGTCAGCTATTTATTTCTCAAAAGAAAAAAAGAGAGGCTCTCATCAGCTGTTTCTGTCCCCTGATAGTATTATTTTCTTCACTTAACTCAT
GGTGGTCTGCATTGTACAATAGTGCCCAATCCACAGGTGAGTTCACTTACAAAGTTTTGTTTTCCCCACAATGCCAGGGTCTCTGTCCGGGAGATGGAGCCACTGACCGAAGGGAGGCAA
CGCCGGAACTGGAGCAAGCCGCCGTACGCTGAGAGGACCAACATCCCCATGCCGGACATCCGGCGCAGCGTCTCCCTGCCGCGCGGGAAGAACCCTCTTGTGTGAATCTAGTTAGTCTGG
TCCATCAGGCATTCTTTCATTGATTTTTACCTTGTGGTCGGATCCGTGAGTTTTTTTACGGCTGGGTAGAAGACCCCATCTGGATCACATCACTTGCTGTCTGTTGAGTTGTTTTTGCGA
TGCTCCCGTGCTGGTTTCAGACAAAGTTTTACGGTCTTTTGCGCAATGTAAAAAAAATGTAGCGTTTGATGTTGTACCTCAGCATCTCGTTTTCAATGGCGATTGAAAATTCGAAGGCGC
TGCTTGCGTATCAATGACTGTGCACTAGCGTTGTTCTTATGTTCCTGAGCTAAGATTTTTATACGATCTGAAAATTTGTTAATATACCCTTCTCCCGAAAAGAATGTCTCTTTCGAACTG
AAGATGAATATATTTTCATTTCAAAGCCTTATCTTTTGCGAAAAATCTATATGCATTATTGTTCATCGAAGGGGAAGCGTCAAAACACTCAAAACTCAAACGTCGTCGAAACACTGAGCA
CGCTTCAGTCACTCACGCGCGGGCTATGGAGGAGGCAGCAGTAAGGGAACGGAAGAGGCCCCGCGAGGGCGACGCGGCTCCTTCCGCCGCCGTGGCCGCCGCGGCGGGGGAGGCGCAGTA
CGTGTACCTGCCTATCGTCGACGCCCTGAAGGCCCCCGGCGCCCGGGTCTGCCTCTTCGCCGCCGTCTCCGAGATCGGCGCCACCGTCCGCAGCCGTGGCACGGGTGAGCCTCACCCTCC
ACCCATCCCCTTCCCTCCTTCCTCCCCACCCGCTTCGGCCCGCCTCCTCCTAGGGTTTAGTCTGGGGTTCTAGCAGGGTGAGCGGTGGAGTCTGGCCTCGTCAGTTTCTGAACCGCTTTG
ATGCCGCAAGCTGTATGCTTCCTTTTTCAGTTCTTCTCCAGTCTGATACGCGAAGGATTCACCTAGGGCTTGTTCTGGACAACAAATGCTGCGGAAACAGGGAATTTGTGGGGTTAGGTT
GTGAATTTTTGCTGTGAATTCAGAGAAATACATTTGGAATGTTGAATCGTGTTGATTACTATTTGCTTGCTGCTCAAAATACTGCTTGCATTGGGGGTAAACCCCATGCTTTAGTTTAAC
ATCCCCCTCATCCCTGCGTCGCCTCTTTTGGTGACCTCTTTTGCATCAAGTCATCATGTAGAAAGAGGGATATTCTGTTGATTCTCTCATGTTGTACTCATATTCAGTGCTGATTCTTTT
CATTTTCTCCTCAAGTCAATGCTGGAATGCTTGGTCATGGCTATAGTTTTTTTTTCTTCTTTTTGCAGATTTCACTCTTACAATGAGGATTGCCGATCAATCACGTCCAGCTGGGATCTC
TGTAACATTTTTTGCAGACAATACTGCTTTATTGCCCTGTGTTAAGTCAAGTGGAGATGTGATCAGTCTTCATAATGTCGTGGTATAGCATAAAACTTTATTTAATTATTCCATTTGTCA
CAGTTCTGGGTATTTCCAAGAGCTATAACTTTCCATGTGCCTTTTCTATGTGTGGTTATCAAAGCCTTTTTTCATCATTTTGATTTTTTAATGACCTATTTGGTAGCAAGTAGTTCATAT
TTACTTTTATCTGCAGATAACGATGCATGGAGAATTTTTTGTTACATTTAACAAAAAGTTTTCTTCATTCGCCCTATTTGAAGGGAAAGTATCTACAGAGTCCAGCCCATATCAGACTTC
TATGAAATATCATGGGAGCAAATATGACAATGAACTTTTGACCCAGATGAGGATGTGGCTTGCATACAATCCTCCAGGTGACTCCTAATTAATAATCACAATTGCTAATTTCTTTAAATC
CACCCATCTGCATGGTATTTCCTGTGATGTCTTAATCATGCTCATCCCACTCCAATTTTATATGTCAATGAAACATCATGGTGGCGAAAATGTTCTTATCCAAATAGGAAGCCAGGCTAT
CTATCATATTTATGGGGCTGAAAGACTAAATTCAGTTTTCAATTTCTTGGTCCGACCAATTAGCATGATGTTAATATGCTTGAATTTATTTAGGCCTTTAGGGCCAATAAGTATACAGTA
GCCATGCAATTTATGAACTCTTCTTACCCGAATGGTTAATTTGTTTTATAAATTTTGAATACAACATGGCATGCATTATCCCATAGTAGCCCTTGGTTAAGGGATGTCTCTGCCTGCCTT
TCAATCAAACACAACAGCAGTTTGAGTTTCGCTGTCTACATCGTTCCTATTTTTTGTTTGGTTGTCAGCTTCTTACAGTAAACTCATGTTACCTTTAACTACCTGCTATCCCTATATTTG
GTTAATATATATGCTATTCTGCTTCTTTAGGGTATATAACTTTATTGTAGTGTAAATTATGTATCCATGTTTGTCTCTGCGCAGAGATTCATGAACCATTTGTATGTTCATGAATACATG
CTTTATCAGCAACTTTTGCGATATCTGCTTCTATCTAACGATTTTGCACCATAGGTATGAAAGAACTTGAATTGCAGTTAAGGAGTTTAAAGTCTGAAACTACTTTTGACTTAGTATGCA
AGGTTAGTTCTTCGTTCAATCACATTGAACTCAGGAGTTATTTTGGCACATTGTTTGCTCAAGAACTCTCTCTGCCTTGCAGGTTCTTCATGTCCATGAAAGTAATGGCGAATGGACATT
TTATGTTTGGGATGGAACTGATACCCCAGCAGCTGAGTTTCAGGCAATGTAAGATTGTAGGGTTATTGCTGTTTATTATTTTTATTTCTGCAATATCTAGCAAATCTATCTATGCAACAT
AGGAAGATGATCTAGTGTTTTTGAAATAATGTTGCAGCTTTCAATCTTTATTAGGTTGTTTTTAAATGGTGCACGGAACCTGAGCATATTTAGTGAAAAGCAAATTACTCTTATCTTCTC
AGAAAAGCATTTGCTGACATCACAGTTCTTTCATAACTAACATTTGTAGTGCTTCTCTGTTATTTGATTGATGAGCATGCAGTTTGGATGCTGAGGCGGTTGAATCGTCCCCTCTACATC
TTGAAGGAACGCCTCTACCCAGGGAGGTTTTATGCACAATGCCTTGTGTCGGAACTGTTCTGAGGATTTTTGCAAACAGGTTTCTCAAGGAATTATTTCACTTGCAAAAGAATATTTACT
GGGCCAGGTTCTGCAACATAACTTGCAAGCAAGAGTTTGGCATTTGGAAAGGCATCTTGGCACCATCTAGTAGGATTCGCCTTTTATCTCATGAAGATGGCAGTGTTGTTGATCGCCTGA
AGTAATCTTCTTTTCTCTCATGAAATTGAGTGTCTTTTGAACATTGTGTAAGTAAATTTTACCAATTGCATTAATACCTTCAGGATGTATGACCGCCGCATCGCCAATCAAGTTCATCGC
CAGCCAATGGCAAGCCTTCCTGAGGCCTCTAATGTTGCTGGTATAGAGCATAGTCTGATAATCTGTATTGCTCCATTGATAAGCATATTCTGTTTTATAGTTCAGACCCTGCATTTAGCT
TCCGATTCAGCACTTATTTGATTAGATAGCAATATTTATGTTAGCTCCTCAGGCCTTCATCTTCATAGTTACCTGAATAAGTTTATTGTATAGCATTCCCCTGTTTTATGTGCACATGAA
GGTTTTTCATGAAAAATAGACCTCATTAATTCATTTTCGTTTGGTACATATCTATGGATATCTAAATGTAGCACATGATGATCTTTATGTCAAAGTGCTTGTTTGCATGTGTTATATTGA
TGAGGTGCTGCGTATGCACGTTTTGTTGCCACCTGTTGCCCACATAAGGCTTGCCACATGACAATTTTGTTCTCAATTCTGTCAGATGTAGAGTATGAGACGGCAGGTTACTCAACGTTG
ATGGAGTCTTTAACTCATGAACAGGTATTTACTTCATTCCCATTTTTCCAGTTATTTAATAGTTTTATGTCTGTGTTAGATTTGCTCTAATATCATCAGATGCCCCAAGAACATGCGAGC
ACGTTTACTTTAATTTCTATCCCAGTGATCTGTCTCTCCCTTTTCATGAGAAGTGTTCTGAACTGTCTCTAAAGCTAGCCAGTTTTTTTTTTGTGCTAGGTGACACACAAATTCAAAACC
CTGGTCCGTGTTGTGGCTGCATACCCATGTCGAGCTAGTGAACTCCGTTTGCTTTTGACTGGTAGCTATTTTCTTCGGTTGACTCTTGAGGATCCTACAGCAAGAATTCATGCATACGTC
CACAAAGATGATGGGGTAATATGTCACTAAATCACTCTTATGCTTGATTGCTTTGCCTACAGACTGCCCCTGGTATCCACATTCATCAGTTATGAAAGAGAAAAATCAGTATTGGTGAAA
GTCTTGCTGAAATAGGTGTTATCCTGTCTTCATCCAAATCCATGGCAGGCCAAATTCTTCGGTGGTTTTCTAACAGCAGAGGCGCTGATAAAAAAGATGAACAAGCTACTGGGCATCCCA
GAAGAGGACGAGGAAGGCGCTCCCTTGACCAGGAACCCACCTTGGATATGGTGTTGCTTGAAATCTTACCGGCTGGACAAAAACGACCCCTGGGGCAGCAGAAGATATCGGGTCTTTGGC
ACAGAGATCAGGGATTGAGCAGGGATGCTGCTTGAATATGCTTGTAAATGAATCGTGTGTGTATTTGTATGTGCTGAGCACTCTTTAGTTGCTAGCTTGCTACCGTTATTGCCTAGAATT
AGCATGTTGTTGCAGTACCGCCGCTAACAGTATGTAATGGTTAAGCTTATGTACAGTCCTTATCTAGAACACTAGTGTCTAGTGGCGTCGTGTGAGCTGTTTCTGCAGTCCTGGACTCTA
ATTGTCTAATGAGATGTAAGGGCCCCTTGTCCACGCCAAGAGTCCATTTTTTCCCCTCCTCCCCCTGTTGTTTGGAATTTCCAGGTTACTACGAAATTGGTGCCGTTCCTTGTGTAATTT
CTGTGATTTGCCGCTTTCATAAGCTCCTGACTGACTGCTTTTTAACCAGTTTCAGACTTTCAGTGGTATTTTTGCAGCTAGAGGGTAGAGAGTCACCTGTTGTGTCTTCTGTTGCGCAAC
CGGCAGCCCAGTGACTGGCGCCAGCAGTGAAGTTGCAGTAGGAGGAGCGCAGGCGTACAATGCCTAACGGCTAACGTCCACCCCAATCCAATCAGCACCCCTCTCTGCTCGGCGGCGCCT
CAAATGGAAGCACTCGCTATCGGATCCGCGCCTCCCCGGCCGGGCCTCCCTGCCCCGACCTGCTACTCCCACCTCCGCCGCCCCAGAACCTTCGCCGCCAGCGCAGCCGCGCGCCGCCCC
CTCGTCGCGGCTCACATGGACGCCGCCGCCTCCGGTGGCCGCCCGAGCCCCGCCCCTCCCCGCTGCACCCGCGCCGAGACGGTCAGCTTCCCCGTGCCCGCAGCTCTCGAGCTCGGTTCG
CTCCCCCAAAATTGCGAGTCGTGAGGTCCGTGTGGGTGTGTCGTGTTGTCGTGCAGGATTCGGAGGTGGGCGAGGTCGCGACGACGACGAGCTCGCACGCCGAGGCGGCGGTCGCCACGG
AGGAAGGGGACAGCGGGAGCCCCGTGGAGGACGCCGCCGCTGCCGGGGCCTCCATCGAGGGCGTCGACGGGATAAGGATCCGGCGGCGGCCCGTGACGGGGCCCGCGGTGCACTACGTCG
GCCCGTTCCAGTTCCGCCTCGAGAACGAGGGGAACACGCCGCGGAACATCCTCGAGAAGATCGTCTGGGACAAGGACGTCGAGGTTTCGCAGGCGAGTCCGTGAGATGTCCCTGTGCTAT
GCGCATGCCAGTGCCTGCCTTAACCTGTGCTCACGTTTTGTGATGTGCTTGCGCTGGGCAGATGAAGGAGAGGAGGCCCCTGTACATGTTGAAGGGGCCGCTGGAGGCTGCTCCGCCGGC
GAGGGACTTCGTTGGGGCGCTCAAGGCGTCGTATGATCGGACTGGCTTGCCTGCTCTGATTGCAGAGGTCAAGAAGGCTTCACCAAGCCGGGGTGTTCTTAGGGAGGACTTTGATCCGGT
GAGTTCTGGGTATGGCTAAATTTTTCCGTGTGGATTTCCAATCATTGCATTTGTGCTATCAAAATTTATCCATTTGTTATATGTGCATTATAATCCTTGTGTAAGTGTAACTACCATTTC
AGTGATAATTTGTCCTGGGCACTCATTTGTGGAAACCTTAGTAAAATGAATCTGATAATTGACTGAACTGATTATCGGCAGTGACACAAACAAGTCGTGATTAGTAATTACTAATTAGTT
GTCACAGAACAATACAGAAAACTATGAGTATGGCAGGACGCCTGTCCTTAACATAACAGATGTGCTCGCAAGCCTACAAGAGATGCAAGGGATTAGAATAACCAACTTTTGAAGTTTTAT
TATATGGATACTGTGAAATAAGTGAATAGAGGTCATCTGGTTGACATTGTTTTTTATGTGATAGGTTTTATTTGTTGGCTTTCTGAAATCTGAATGAACACATGATTTTGTATTGAAACC
AACCAGCATCTTTTGCCATGTAATAATGCTTGTTGGGGCATAAACAGGTTCAGGTCGCTCAGGCATATGAGAAAAACGGGGCAGCATGCCTTAGTGTTCTTACAGATAAAAAATACTTTC
AGGTCATTAATTTCTTCACCTTGAGAATTTGATCTAATTTCTATTGACCATTATAAAGTTATATGTCCTGAAGACACTTGTTTTCCTTTAATACGTAATCAGGGAAGTTTTGACAACTTG
GCAGCTATACGCAATGCTGGAGTCCAGGTGCTATGTCCATATTGCATTCATACATTCCAGAAGTCAATGATGTTCAGACAGGGTACTTCAAGTGCATGAATAGCTGAAGTTCTGTATTAC
TCAATGCAGTGCCCTCTTCTGTGCAAAGAGTTCATTGTTGATGCTTGGCAACTTTACTATGCACGGTCCAAGGGTGCAGATGCTGTTCTTCTAATTGCTGCTGTATTACCTGACCTTGAT
ATCAAGTACATGTTGAAAATTTGCAAAATACTTGGGATGGCTGCTTTAGTTGAGGTTGAGTTTTTCTTGTGATATATTTTACATGTTGTTTCAACTGCCACCACTTGTTGCTCTCAAGTC
ATTTGATTTAGTGATTCAACTGGACTGTGTTACTGAAGGTTCATGATGAAAGGGAAATGGACCGTGTTTTAGGGATTGATGGTGTACAGCTCATAGGCATCAATAACCGTAATCTTGGTA
TGTTGTTTTTATTAATTTTTACACCAAATTCAATTCCTAGCTATTTTATTGCCTGAAAGCTTGCATTTCATATGTCACCATAATATGAAGATTCAGTTGCATGGTAGAGAAGTGATTGGG
GGGAACATACAGTTAATCTAGACTATTTCAGTGCTTGCTGTAAAATTCATAACTAAAGCATAACATGATAATGTGGTCACTGTGAGAAAAGGTTATTATACACATTATATCTACCGTAAT
TCTCCATATCATGTTATTAATTATTAGGTTGAATAAGTCTGAGGACATTTCCTTTTCCAGAGACATTTGAAGTTGATATTTCAAACACCAAAAAACTTCTGGAGGGTGAACGAGGAAAGA
TGATAGCTCAGAAGGATATAATTGTAAGTATTTTCTTTGACATAATTCTTGTGAAAAGCAAAAAAGAAAAATAAAGCCTGCTTCCTCTTCCACTTGCTACGACTAGTTTTTCCTGCGCAG
CTATGCCTCTTACTATATGCAACTATTCACAAATCACACTTTCATATACTTGAAGAATATGTAAGGTATACTTTATTGTCAAGATTCTTATACAATTAGATAGGATGAATCACTGATCTA
CAATGTGCAAACCTTGCATTGCAAATATTCGACAAGTAACTATGTTTTACTTGGTAAATTTTAACATCAGTAGCTACTATTGGGACATCAATTCTTTATTTCCTCATTGTTATTGTGATC
TAAAATTACCTGACTATATAGCATGTCGCACTATGCTGTGAATCAGGTATATGTACCTTCACTTCAAACTGTAACTCATTGATGCCATTACACCTATACTGACATCAATATCCAGCAGCT
ATGAAAATAACTGCACCATGCCACACACTTGACTGTGCATAGGAAGTAGTACTTCATCGAGCATTCATGTTCTTTTCTATGTTTCAGGTTGTAGGAGAATCTGGACTGTTCACCCCTGAT
CACATTTCGTTCGTTCAAAATGCCGGGGGCAAAGCGGTAAGTCATCAGCCACGAGACCTGAACTCCTGGCTCATATGACAAATTCGCGTTCATTTGCTTATTTGTGGAGCTGACGACTCA
GGTGTGTTCGCTGTAGGTTCTCGTCGGGGAGTCCCTCATCAAGCAGGAAGATCCAGGAAAAGCAATCGCTGGGCTTTTCGGCAAAGATATTTCTAACGCTGGTGCTGCCTGAAGAAGCTG
AAGGGCCGGTCAAAATAAGCGAGAAACTCAGTGCTGGTCACATCATTTTGTATAGCTTCGGAAAGATGACTCCTTCGGGGCTTGTTTGGATAACATCAACCCTTCCAATAAGTATGGATT
TGAGTGAAAAATAAACTAATTTTCATGTTAATTCCTCCCAATATGTATGGATTGGAGCCTTGGAGGGATGTCATGTATCCAAAGTTCCAAACAAGGCCTCGGAGGGTTTTGGTAGGTGGT
TTTGTTTATCTGACCTGATCAGAGACTTTTCTATACTGCAGTCTTTTTGTGAACTAACCTTCTCGAACAAATGGATACATGATTATAGTGCACAAAGATATATTCGAACGAGTTGGACGT
ATGAGAGCAGCTTGATTTTGCCTAAACTTGATCAGAATTAATGATGGTCTTATACTACCATTTTTTTCCGAGTATTATACTACCATTTATGTTCGTCCTTGTCGTCTTGTTTGGAGCATG
GAAATTTAAACTTCATCCAGTAAGAACGTAAGGATTTGGTGGAGTAAACCTTTTGAAAATGAAATATTCTGTAAATTACGGCGAAAATTTGTCTACGATACACACAGCCCAAAAAGCTCG
TTCATGACATTTTCGATATATGGGCCATATGCCTACGGGTTACAGTCCACCTAGACTCAAGCCCAACGATCCAACCCCCCGCCGCCTGCCTCCTCCACCCCCGTCCTCCAGCGACGGCGG
CCATGCAGGGCTGCCTCCGCCGCCTCCTCCGCGCGCCGCCGCCCAGGGCCCTACTCTCCCGCGCGCTCTCATCCTCGCCGCCTCCGGGAGGCGGCAGCGGGGTGGCGGTGAAGCAGGTGA
CGCGGGGGAACCTGGCGGAGGCGCTGGAGGAGCTGCGGGGGCGCGTGCGGGAGGCCACGTTCGTGGGGCTCGACCTGGAGATGAGCGGTGTCACGAGTGCTCCCTGGAGGGACACCTTCG
AGCTCGACCGCGACGATGTGCGGTACCTCAAGCTCCGCGACTCCGCGGAGCGGTTCGCCGCCCTGCAGCTCGGCGTCTGTCCCTTCCGATGGGACCCCGCCAAATCCGCCTTCGTCGCCT
ATCCGTCCGTGCCGCTCTGTCTCTCCCAAATCTCCTTTCAGTTCTAGTAATCCACCCATAGTTGAGGATCCGCGTATAGTGAGCTGAATATCTGATTGGTTTTGCGGTTTGCGACTAGCA
GATTTGTCTGCTTCAGGCAACAACATTTTGGCCTTGTTTGCTGTAGAAAGTTTCGTGGTGATACTTCGAAGGTGGAGAAGTCGCATTGAGGTTCTTTTGTTTTGAGCTGTTATTAGCAAA
ACAGCCAGTATTACCTATTGGCCATTGATCCTAATAATAACTGCTTACTGTGCTTTGTGCAATGTTCTGCTATGATTAGCTCATATTGAGATAGCAATAATGGAGATTTGAGCACCTAAG
GAAAATGCTGATCAAGAATGGTTCGTGAACATGTACCTTGCAAAAAATTCCAATATGACAAAATAGGTTGCAATGACACTGCAGAACCTGTGTGCTACCTGCTAGTGCCAAGCACCATGG
GTGGACACGGACGCTGCTCTGGCACACAGCCAGTTGTGGCAGATTAACCCCCACTTTGGAAAATGATTTTAGCTTCAGAGATGTGGAGGGCAGAGCCGGACACATGTCCAACACTACCCA
GGCCCAATATAGAATCTTCTGTATGTATGTCTATATCTGTCTTAGTTGTGAGGGTTTGCACCTTTGCAGCGTGTGTAGTTGTTGGCTTATTGCTGATTGTTAATTGTTGATTGCTTGACC
ACTTACTAATCAGCTCTGTAGCTGATGTTTTTTCAGGACTAACCTTTTCTTCTTGGCAGGCATAACTTCTTTATCTTCCCTCGCAAAGAGCTTAGTGATTGTTCATCTCATGAGTTTCTT
TGTCAGACAACTTCAATTGACTTCCTAGCAAAGTACCAGTTTGATTTCAACACATGCTTCCGTGAAGGTGCTTTCTCTTACCTATAATACTTGGTTGAGCTGTTACTTTATGCATTTTCT
CTGTCAATTAAGATTGCAAGATGTGCCTATCACACATAGCTTATTTTATAGTTCTTCATTGTCTAGTACATAACAGACAAGACCATGCTCCATGCATGTTTTTCCCTCAGGTACTTGTTC
ATTTACAATATTTGGTTAATCTCAGGAATATCTTATTTATCCAGAGCACAAGAGGAAGAAGCACTACAGAAATTAAATTTTTTTCATCAAGATCGACCATTTTCATCTTCCGCCACTTCC
GAAGGGGATGGAGATATGCCTTTAAAGAGGACGGCTGATATTCTTTTCACAGAAAGGATGAAAATGAACTTCAAGGTATGGCGTGATGTGATAATCAGCCAGCCCGATAGCCATTTGTCA
GGAAACATTAAATGCACCGCAGGACAATTCCAGACAGCTTTCTTCAAAATGCGGCCAGCTGTTATACTTAATGGGTTCTCATCACATCAGTTGCAGCTAATTCAACAGGTATTACTTAAC
TTGGAACTTAGCAATAGCTGGGCAGCTAAGTTGTTAAAAAAGATACTGCATTTGTTCATGAGGTATATCTTTGTTTCAAAAGTTCTGAATAGTGTTCTTATGTGATCCTCCTTTTTATTG
CTTATTTGATGTATTATACTTACACGCACATTTGATGAAAAAAGTAGAAGATGACCACATGCCCCTACTAAATTGTCTGTTTGTACCTCATTGAATTGTTCAATTTATTTTGTGTTCTAA
AGCACTCAAATTGACCAATGGCCAAAGAAGTCGATTCCCATAACTTGTATAATGTAGCACGCAGGANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAGTTTTTCTACATTCAATGTGTGTTGGGAAACTCATAGAA
TGGCTACTTTGCACTCCTAAAACATCAAAGGGAAGCATTGATCCTTATAACATACTTCTTATCAAACATGTTCTGGTTGTTGTCATTTTATTTACAGTCATTGGTTTAGATTTAGGGTAT
CTTAGTACTATTGTGTTTTTGGCTGCATATTAGGCAGTGTGCGGCAAAATTATAACGTTTCTTGGTACACTCTATATCGGTTTCTGCTCATATAGCATGCTTGTCTGTGCAGGTTTTGAG
AAAAAACTTTAGGGATCTTGTTTATGTCTGTACATTTGGTGAGGATGACACATCTGAAAAGAGAGTAGTTTATTCAGACACCGATGAGGATAAAATATTGCTGATGGTAAGAGAAGTAAC
TTATTTTTATTTGGAATGGCACATGATTTATTACTTTTATGATCTATACTGAGCCTATTTCAAGCTGGAGGTCATCTATTTGACTTTAAGTTCAAATGATGCCATCCAGCTTTCGGAATT
TGCTCCTATCCTTTCCATTTGGTTTTAAACTGAAAAGGTTCAATCTACCGGTATCACTATATTTACGATCATTGTTCCACTAATTTAAGCAATAGATAGTGATATATGTTTCTACTTCAA
TGCAGAAAGATGTGCACGAAGATCTACTGAAAAGCAGGGAAGCAAGAGTCAAATCAGCAATAGGAATCCGCCATGTCATTGACCTTCTTTCATCGGAAAGGAAGTTGATTGTTGGCCATA
GTTGTTTCCTAGGTATGTTCTCATTTGTCCTTACGAATAATTTATGAGAAGTAACCCCTCAGTTCACACATGGTGAGATTCCCCATGCACTGCAGTAATGATTTCCTGTCATGGGAATTT
CTGCTCAGATGTGCTTGGGAATTTGGACCAATCGATACCAATTGAATTGCTGATTTCTCTAGCACTAATTCTCGTGCTTCTTCTCAAAATTTTGTTGTGTTTAAACAGATATTGCCCAAG
TGTACAGCAAGTTTGTTGGTCCTCTTCCTTCATCTATCAAGGAATTTGCCTTAAGCATCCACAAAATTTTCCCACACATCGCAGATACCAGGCATCTTATGAATGTCAATCAAGCAGTTC
AGAAACTGATGAAGCACAAAAGCAAATCACTGTCTTCAGCTTTCTCATTGTTGTGCCCTTCATCTCATTCATATGCTGAGAAGCCATCCAGTCTATCTCCTGTGAGAATTGAAGTTGGAG
GAGATGAAACAACGTATGGTTTGTTCTGGATCCTTGATATTTGATGCACCTAAATTCTTCTGATAATATTTACTATGCTTATGTGGTTATGCCCAAAACTTCTTTGGCATGTACAGAGAA
CATGGCCACGAGTAGTTGGTTTTACACAAATTGACATATTGATACTTCTTTTGTCTGCCTGCTATCCTGCAGGTCTTCTTGCTTCGTTTCAGGTGCTAAGCATGAAGCAGGGTATGATGC
ATACATGACTGGATGTGTTTTTGCACAGTTGTGCGCTTATCTTGATGTCAAATTTGAGCAGCTCTCACCTCAGGATAACCTAGCCACAAACAATAAGCTGCAGAAACACATCAATCTTTT
GTCCCCAAGCTGGAACAGTGGAACAGTTCTTGATTTAAGCAGTGGCCAGGAGAGACCAGATCCAGGTTATATGAGAAGGTATCCTGCTGCTGTGTATGATAACATTGTTCTCATCTGGGG
ATTCATGTCTAAGGTCAGACCAAAGGAAATTAAGGATTGCATCTGCAAAGTGTTTGGTTCAGGATCCATCAAGACCGTCTTCTCCATCGATTCCACCGCTGCCCTTGTGCAGTTTAAAAA
ACAAAAGACTGTAAATGAATTCTTGGATTTGAAGGCTCTTTTAGAGAAGACGGATAGTGCTATCTCAATTCTACACCCCTTGTCAACTATATTAGAAGGAGGCCAAACACGAGCCGTGAA
ATATGATACCTACAGAGACATCTGCAGCTCTTCTGAATTAAAGTATCTTTTTGCTGATCAAGCTGAAGCATTTTGTGCAACTTCAAAGAATCAGCTCCAAGAAAATGTTGATCACAGTCT
TATATCTGGTGTGCACCAGACAGTGCTCACCTCTGTAAATAAGGGAGATGGAACAAAATCCGGTTCTATGAATGAAGACGATGCTGCCATACTTGCCAGCAGCATATCTTAGATGACGAA
TGAGAAGCTAATGACTGCTATCGACCTTTTTCCCACAGGTTTTTAGCCTTTTGCCTTTTTATTTGTGGCTTATTGTCCTAGGTCTAGTAGGGAATGTTTTACCAATGTCTTTTGGCACGG
TGCCATCCCTCAAGCATTGAACTACAGAATAACTCCATACTTATGCAGGGAAGCCAATTTGCAAGAATGATTAGTGCATTCTTCCATCCTCTTTTATGCTCGGAAGTCCTGAATTTTAAC
CCTGTAACCACTTAGTTTAAGTAATGGATGTGTAAACTTTTATTCTTAGTAGTAGGACAAAAAATTCTGTACGATGCACGCACGGACAAAATCANNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAGTACAAAATACTCAACCCTATCTGTCTGGCTCTCTCATTGAACAGGACGTGGGG
GATGTTAATTCTACGGACACCGCATTCCACTTGTCTATCTGGGACTTCCGGTCAAACCCAAAGTATAACACTAGACTATGCAAACCTCCATTTTGTTTTTTAAAAAAAAAACACAGTACA
TAAATACATGCGCAAGCATGTATTAGAGCAATTGAGCACTCAGACTCAGGTGGGAATGTTCTATGTTCTTAGAGCATCTTCAGCTGACTATCAATAATGATCCCCAATAAGTTGCTATAT
TTTCAATACCTCTCTCCATATATTTTATTTCCTTTCATTTCTCTTCCCTTTGCATATTGTACATTTTATTTTAACTCCATTTTCATCACACTATAATAATTCAAACTTTTTATGAGAGCA
TGTGGATTGTCTTCATAATCATCTTCAAAGCACTATGGCCAAATTCCCTAGCAACATTTCCATTCTTTTTGAATTGTGTGTGATTTTTTTTGAACCAACGGGCACCAGAAAGAAATAAAA
GAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
CATATTTAGTTTTGGCGCTTTGGCACATCCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGACGATGACCAT
CCCTACAGTTGGCTCGTCAGTAGGCCAGCCAACCTCTCGGTCAGCAGGCCGCGCGTCTCCCTCCATGGACGAGGCCTGCGCGGCTTGGTTCTGGGCCATCGAAAAGCCTAGAACTTTCAT
GGCCTGACCCAGCTCCACTACCGCATCCAGCCCGGTGGCCTCGGATGGGCCTGCACTGTGGCCTAAAGCACACTTCACCTGCTGGTGGTTCTCTCCCTCTTGCGCCGCCGTGCCACCAGC
CGTAATTGCCACCACGTCGGCAGCCATAGTCGTCACGCTGGTGAGCTTCTCTTGCTGGTGAAGGGTCGTCAATGTGCCGGCAACCATTGTCGCCACCACACCGGCAGTCATCGCATCGGC
AGCAGCCGTCACCGCTGCATCTACAGCCATCGCACTGACAACCGTCTTCATTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNACCTCTGCAATGGTCAACGTTGTTGC
CATTTTGATCCTGGTGAATACGCGTGAAGTTGGGATTAGGCACTCACTCTTTTCCATCTCGGACCAGGCTCCGTTCCTGGTGGCAAGGGAAGGCAGTGTTGGCGTCAGCGTGTCCACGAT
GCCGATCCTGCTGGAGAAACAGCAGGCCTTATTGACGTAGTCTATCGCGTCGTGGAGCCAGGAGTAGGCCTTGTCACCAGGACCAGCTTGAGCGGCATTCTTAAGCGCTAGAGCCTACTT
TCTGAAGATGGCTTGCAGCTCCCCCGCCAAGGCGTCACCTGGCGTTCCTTAGTGGACCGTCAGCATTCTTAAGCGCTAGAGCCTACTTTCTGAAGATGGCTTGCGCAGTAGCTCCAAGGC
GTCACCTAGCGTTCCTTAGTGGACCGTCGGCTACCACCCTTGAACTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTGAACGGCGGTCATG
TTGGTCGTCACTTCATCGCAAGCTGGAGGCCTCACCCTAGCTGGAGTCCAGCTGTAGCCTTGGTCAACATGCATGCCACGCCGGTACCCCCTGCCTTGCTCCATCCTTGCTTCATGGCCG
GAGTAAATGTGCCCCTGCTGCACAGGGCATCACAGAGGAGTAAATTCCTGCAGACGTTGTTGCTGTCGTGCAGAGGAGTGAGCCGGTGGAGACTGACGCACCGGTGGGTGGTGGGCGGTG
TAAATGCCACTGCAGCGAATCCGACGGCAGACCCACCGCGCCTGACGATGTCTGCGTAGGAAGGGGCGGATCCGTCATGGTGGGCTCCGGATCTGGCGTGGCTGGTACCCAGTCCACCTC
ATCAGCAATAGGATGACCATGGCGGGGTGGCGGCGGCAGGGAGTCGCGGAAGGAGCTTTCTCAGGTGGAAAGGCACGGCGACGGCTGGTGCTGCTGGATCTGAGCGGGGGTTGGCTGGCT
GGATGCCTGGCGGTGGAGGATCTTGAGCGTGGGGATGGTTGAGGCTTCGCCGGATGGTTGCGGCGGCAGGGCGGCGGAGGGGGTGGAGAGGGGTCGGGGGGGCCCGGATGTTACTCTGAA
ATTATTATGGAACCCTCATTTTTTTAGCCTTCTTGCGTCGTCCGAAGCGTGGATGATGAGCTTTCATGACATTTGCAATCCGTCGCCTAAAAGGAGCCCCGCAAATCATGGGGGGACCTC
TGCAAAGCAATCTTCCAAAAGCCTATTATGGCCGTGCTGCTTGTTTCGACAAACCACCACATGCCTTTAGCACACGTTCATGCCGCTAATATGCTACAATCAAACCCGTCGCTGTTTCAA
AGTCACCATGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNTTGCATCATCGTTTAACGAGTCATCAAAAAACATCTGCACAAGCGAGCTCACTGCACCGAAAATCTATAAACAATTCCGTTGAACTGCACCACGCTGAAGTGAACAGGTTGCATC
ATCGTTTAACGAGTCATCAAAAAACATCTGCACAAGCGAGCTCACTGCACCGAAAATCTATAAACAATTCCGTTGAACTGCACCACGCCTCACCATTTTGATCATACCAATCCAAAGAAA
AAGAAACATTTGAGATCACCTTTGCACTAATTCCGTTGAACACCTTCAACTCATTGCCGGTTGGAACAAAGCGGGTGGACAGGGCAGGGATCGTGATGAGTGATGACCTTGTGGTGGCCT
CGCCAAAGCTTGCAGTGGCCAAGCTAGACAGCAAGTGGGCACCGGTGGAGGTCGGGGCACCGCCGCACCGTAGGGCGCGGTCCGTGGTGGCATCATGGGGCGCGGTGGTAGAGGTTGGAG
TCGACTGCGAGATATCGGACAAAAACTTGATGCATCAGAGAAAAAAAAGAGTGTGGAAGTTCCTTATTCTTATAAGCTGGCAGCATCGGATGGCAATAGATCCTATCGAATTCTACAAAA
TATATTTTTTTATAAGATTTGTTATATAGTGTATACCAAGTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTCATAACTAAATCATTTAAAATTCATTTTT
TACCAATTATTATGTAGCATCATAGGATACTATAAGATTTCAAATAGCATCGAGTGAAACCTTTTGTAGAATCGGGTACGATAAAATTCAAGATACAAAGTGGGATCGGTATCGTTCTAA
CTTGATAGGATCGTAGTACCCTAAGATTACAGTCATACGGATCGGAATCCTGATATCCTTGCTAAAACCTCCAATAATAATAGTTTTATACTGGAAGGTGATATTCAACCCCACCCCTTG
GAATTTTAAACATCTCATCCTTACTTTTTCTCTAGAGACGTATATACAAGCTGAGGAAAAAGGATAGTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCGCCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTTCTGATTTTTAGCACATCAAAATGTCC
AAATTCCAAATTGCACGAGTTTTGCAGCCAACGCCAGGCTTCTCTTGGTTGGGGACTTGGGAACTTGGGATGTGCCTAGCCCCCTAGCGTGATGAGTGATTGCGTGAAGCCGTGAACATG
TTTACAGCTGTCACAAAGAGGAGGAGCGTCGCCCTGGCCCTCATTCCGGCCTTCTGCCTTCGGCCTGCCTTCCTACTACAGTACTACTCCAGCAGCCTCTGCGCCGCGTTTCGCTCTGCC
GTGTGCTTGCGCTCAACTTTACCACCCAACCAACGAAACCACACGCTAAAACCCTCGTCCTCGCCGCGCCCGCCTCCCCATGGACGGGGACGACGCCGGCGGCCATCTCGCCGCGGCCTC
CGCCTCCCCGCGCGCCGAGGAGACGATCGCCGCGGTCCGGGGCGACGCCTACGCCGCCCGCCTCCCAACCCCCTCCGACGACGAGGAGGACTGCGACGACCTCTACGGCGACGTCAACGT
CGGCTTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNGGTGGCGGCGCCTCCTCCTACTCCTCGCCGCCCAGGTACACGGCGCTGTACGTCAGCGACCTCCAGTGGTGGACAACGGACGCGGAGGTGGAGGCCGCGCTCCCGCACGG
CGCCGCCGCCGCGCTCTGCGGCCTCCACTTCTACTCCGACAAGTACACCGGCAGTCGCGCGGCATCTGCCGCGCCGAATTCCGCANNNNNNNNNNNNNNNNNNNNNNNNNNNNTGCGCTC
CACGGCCGCGCCTTCCATGGGCGCCACTGCGCCGCCTCGCTCTCCCGCCCGCCCGCGCTCCACCGCCTGGGCGACGACTCTGACTCCTGCGGCGAGGTGGACCGGGCACCGAACCCCACC
CGAGGCCCCGGCACCGGCGGCCGTGGCGCGGGCAGCGCGACGACGGTACGAGGCAATGTGGGTCCTTTGTTGGGTGATCGGCCGACTCTGCCGCCGCCTCCAATGTCCGTGATTCCCCGG
CCGTCTCCCGGGCCGCCGTTCGGTGGCATTATGGGAGGTGTTGGTGGGTACGGTGGATTTCAGTCGACGGGGCAGTACAATGCGGGGATGGGTACTGCCATGGTGCCATCGCCGGTGGCG
CCCTACGTGAACCCGTCGTTCTTGGTTGCCGGCGGGATGGCTATGCGTGGCCCGGGAATGTGGCATGATCAGGGGATGGCTGGGGGCTTATGGGGTGCTCAGAAGGGGTGGAATTTCAGA
GGTTGTCAGATGCCATGGCAGCAGCTTGCGCCACCAGTGCAGCACCACCAGGGCCAGGCACACCAGCAGTACGGGAATGGGAATTATCGGAAGGGGCGTGGCATGAAGCGAGAAAGACCA
AGTAGTAGGAGTGAGCACAGGAGCATTGGCAATGTGAGCTATCCTGATAGGAGGCAATCTGACAGTGATGGGGGTGATTTGTACAAAGAGCAGGACCGTGAGGAGAAGGGTCGACACCGG
GAGCGTGTCCTGGAGAAGGAAAGGGAGCAGGAGAGGCACTGGAATGAGAGGGATCGGCATGGGGGTGACAAGAGGAGGCACCAGGAGTACACTGATCATGCTGATTTCGATAGGAGAGGA
CGGGAGAGGTCGAGGAGCCAATCAAGGGATGATGGTGATGATGATCGTCCAAGGAGGCGGCGCTAATTTACTGTGCACCAGGAAGCATATTCTGACTAAATGGTAATTACCATTCTAGAA
AAGAGATTCTTTTATAAATGTTCTGTTTTCTCCTATATAACTATAACTAGCATGAGGTTGTTTTTTCTCCTTTCATTTTTGGAGCAACCCATCCATACTAATCTGGTTCTGAGTTGCAAC
TTCACACATCTTGGACTTATATATCCCTAGTTCTATCATGCAACCAGAAGCTCTTCCCATCAGTCATATTCTAGTGTAAATGTACATACACAGCTCTTGTTGTAACTGAGGATGGTGCCC
TTAACTCCTTAAGCACCATGTTGCACTATAGTGTCTAAAAGAGTGTAAATTTTGAATTTGAAAGGTTGATGCATTATTTTATTCATCCAAATATGATTCCTTTTCCACTGTTAGTCAATG
GAGTAGGATTGATGTCTTGTTTTCTAGGAGAAGAGATTGATCTCTTCTTGCCCCCACTGCTGTGACTGCTTTGTTTGATGGTACTACGTCATCACTGTTAATTTGATATAATTCCCCTTC
TAGATTGCATCTTGTGTGAGCAGGTAGCTATTTATTGGTTACTGTGTGGTGAATTGTTACCACTTGTCAGTAGTCAGTTATGTTGGAGATAGTGCAAAAACATATCTATATTCATTGTAG
TCATGTTGGTTGACTATTTTATGACTTCATCACGTGCTATTTTGTATTGGTTACATAAATCAAACGCTTTGCTGTTGACTTATGTTATCAGCATGCCGCTTTTCTCCTAAGTCTTGTTTT
TATGCCGTGTCGTGTCATACTACACATATTCACATTGAAGAGTTTCCTTTTTCATGAGAACATGTTACTTGAAACATGCAAAGTAATTGATCCTATCATGATATTCATCAGTTGGGATCA
CAAAGCAAGAACATACTGCTGCCATTCTGTTGGGAACTGCCTTTTGCTGCCTTTCAGGCTTTCAGCACTTGTGCTAATTAAGTGTTGCATGGTACTGTATAGTTACTTATCAGAAACCTG
GTAATGAAATGAATGTCCCTTAGCACAATATACCCTGCTGTCAGCATGGCACAGATCAACGTTCATCTGCTAGTGTTTGATCTTTGACAGTTACTAGCATACATGTTTGGGCATTGTATA
TGTTTAACTGCGCTCATGCATATCCTCCATATGTATACCGACCGTGTACTGGCATATGTTTTTTACATGCTACTCAAACTAAACAAGACACTGAATTCGGTTGGTTGAGGTTCTGCTGTA
CATGAGTGCTTGATGTAGAACTCATTACTTTCTTGCATGGGAGTCTTGAAACTTAATGTTAATGGTATGCCTGTGAGGCTGTGACTTCTTTTTTTCTCTTTGAGCTAGCTTTAAGGGTTT
CTTTTCTGCTTCATCTTTTGTGAGGTGAGCTTGGCTTTTTTGCTGAGAGAATGTTTGGAGGGGAAAGGATGAACTGGTGGGGGAAGTGTGGATGATATTGTGAATCGAGTGGAAAGGTTG
TCAATTGTCATGTCACAAATTCTCACATTGCAGTTTCAATTGGTTTCAGTTCACCGCTTGCACAGTACACTAAAATGTAGTTCTGAATGAAGGAAGGATCAGTGGTAATAGATGAAATAT
AATAATTGAGAGGGTATTGTTCTTTTGGTGAAATGAACTGGGAGAAGGTCCATTTGATTCACCGCTAGAGTTAAGATGAACAAACTTTTACTTGAACACTCTAAGGTGCCTGATTCATGC
TGACACAGGGTTCGTCCTCCACTCTGTGGTCACTTGGGCTCTTAGAATCCAGGTTTCCATACTAGTGTTTTGCTGACTGGATGTTGGGCAAGCGAACCCAGTGTCTCATGTTGAATATCT
TGCTGGACTTATAATCAATCAGGATATTGGAGACTAGTGGCCTTGTTTCTTTGGTGTAAGTTGAGAGTGTGTAATAGTCTAGTTCCTCTAACCATTTCCAGAGTTTTCAGCTACTGAGGT
TTCGAGTAAGGGATTACAGTTTACATAGTCCAATTTTCTGCTCTGAATGATTTGCATGTAGCGTTCTTGATACCATTCAGTGTTCTTTTGTGTTCTCCAATAGATTGAAACACCATTTGC
ATAATTGATTTTGCGGTAACAGCCCTTTCCCTCCTCGCAAAAACAAAATGAGTTACAGTGCTTTCTCGCAAACGTGGATTGATTTTGTATAATTCCTGTCCAAACGGGCTGACCTTGTTA
ATTCATATGTGCAGGCAGATTCATCGTCATGTGTGGTCCCGTTCAGCAACCTCTGCTCTCCAGTAGTTAGTTGCAGAGACCGGGATTAGCCAGTACCCAACTGTTAATTGACTAAAAGGA
ATTATCTTCAGCTTCTGCAGTAGTTAAACTTAGCGTAAATTATGGTGTCCTTACTTTTGGCGCAGACTACAGCGTTATTTAACTCCAGAAAATACAGATTATACTCGACTCGGCTAATAT
AAGCAGACTTTACTTATCGCTGCGTATCATGTGGATTGTGGGTGTGTGATGTATCCAATCTTTTGAGTGTTTCCTCCCAGCTACCCAGCGTAGCATGATTGCTAGTAGTTGATAAGAGAT
AGTAAGATTCATGTCAGAGAAAGAGAGCGGTGTATGTTTCTGTAAGATGGATAGTGATGAATACCTGGTAGCTGCTTCATCTTTGATCGCCCTTATTGAGGCCAGCCAAATTGAGCATTT
GCCGTGTGCCACGAAGATGGAGTTGCATGATCAAAACTGAGCCTGCTGAGTGCTGCGCAAGCTTTGTTCTGCTCGTGGAATGGTAGCACGGTTAAAGGTGGACGAAGCTGAACGCTGCTC
CGCCTTGACCCTGGAGTTTATTGATGGAATTCAGGAGTTGAGACTACAAAACTCCAAGATATACTCATTAAACGGATGCTTCGTCGTACAGCAAATCCATCCCCATCCTGGCCTATATGG
CCATACGCACGGGTGCTGCAGATCTGCACTGACGGATCAGCTCAGGGCGCAGTGCTTTCCGACCCACAGAAGTGGACGATAGAGAGAGATTCAGAGAAGAGAAGACAGTAAGTAGGTAGA
TATTCAAAGAAGAGAAACATGGCAGCAGTCCTGTTAAACGCGATGCAGCAGGGGACCATCGGCGCGGCGAAGCGAGAATGCCGGGCAGCCGGCCGCGCATAACAACGGCCCAGCCTCTAG
GCTCTAGCGGCCACGCACCAGTGTACGGCCGCGCCCAGCCCCACGAACGGACGCACGGTGCTCCGGCTCCCGCCGGGACCGGGAAACCGCGGAGGCGCTCGGTGCTTCTCTCTCCTCTCT
GCATCTCTACGGTTCTGCCAGTGCCAGACTGACAGCCACGGCGGGCGTCGCCCCGCGCGCGTGGTGGATGGACCCAGTCTTCCACGGGTTGGTGGGGCCTCCACGTCCTGGGGAGCGAAC
GACGGACGGGCAGTTATACTTGTTAGGCTGGGCCGTCCACCAAGTCTTGGGCCGTTCGCGCACGTTGTTTGTTGTTGGGGCAGGGCAGAGGCAAGCCTTGGGCCGCTCGCGTACTGAAAG
CGACGTGTAGTCGTGCACACCGCCTGCAGTGCCTGCCTGGTCGCCGCACCTGCCGCTGCTACTGTAGTTGGAGGGGACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTAGTCGGTAAAGATAGTCCCGGCCCCCGGGTACAGTGTACTCGCACATTTCGGTGCGTCCGCCGGCCGGCGTAATGGTCTTGGCCA
GGAGAAACGTCGGGTCCATCCATCCTAACCGCAGCAACGGGCGCATGCGGTTGGGCGCTTGCTGCTGCTGGTTGCTTTTTCGATGACCCAACTATCATCCAAGGCACGGAGCCGGCCGGC
GGGGCGTTCCTTTCAGCGAACCGACACCGACGGCAACGAAGGTAGGCGCCCCGCCCTCTTCTGGGATCCTGGCCGGTGGAAGAAGCCCGTGAAGTAAACGAAGCGCACGCTTTCTCGCTC
GGCCCGGCGCCCGCCTTGCCTAAACGGCTAAACGTATCCTATTTATCTCCAGTCAGCTCGTCGGCGGACTGGCCAAAACGCCTCCTCTCGCGGTGGTTCGGTAGCCCCCCGCCCCGTATT
CTTCGCGAGCACGCAGAGAACACGGGAGCTGCTCCACGCAATCTTCAACAACACAACATCTCACGCTATCACGCATGTGAGCTAGCGGCCGGCCGTGTGTTCCGTGGTCCGTACCGTGCG
TCGTCTTAGAACCCAAGGGATCCGAGGTACAGCCCCCCGCTCACGTGACGTGACACTCCCAGCGATCGATCGAAGCAAAGCAAGTACACGGCCGGAGAGAAAGAGCGCGCCCAGGTTTTA
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTAGTTACTTTAAACAATGGGGCATGAGAACATGGAGGTGGTGTCAGCGAGATCCTGGAGAGAATTCTCATGCCTTGGACTCTGCG
AGCAGTCAAATGATTGGGCGCTGCTGCCTCCCTGCACTGCACGCTCGCAGCTGCGTGCCCCCAGGCCCCAGCCGGCCGGTTTGGACTTTGGGGCTACTAGCGAACACGGCACTAGCTGAG
GCCCCCTGGCCGGGCCACATGCGCTGTTGAGTGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTTGTTTCTCAACAAAAAAAAA
AAAGCTTAGCTCTTTAGCATTTGAACTTGTGCTTAAGCTAATCGGTCAAACGGCTCACTCTCACATGGCGAGACGAGGTGTGGTCTCCATCTCTTGTCCCTCTCGGGAGGAAGGGTACAG
TGGACTTTGAGAATATTTTTTTTAGTTCTTATTAAAAAAAACACGCTGAAGTAAACAAAGTGAAAACCAGTGTAGTAGTTCACTTTTGTTTTTTTGGAAAAGTGAGTAGTAGTTCACTTT
TGGAGTTTGGATATAGTAGTACACTGTACTCTCCATTTTTTTCTTTTCAAAAAAAACTCAAGCAAATTGAGCTGATTTTTTAAAAATTACATGTGAGTATACATGTAGTATGTTCCAAAG
GAGAACAAAATGTTTTTCATAGACCAAATGTGCTATTAGCAGCACATTTCAGCTTAATTTCCTTAATTAGCACCATCTTACCAGGCAAATTAAAGAAACAGGCAACCAAGTAGTACGTGT
TGCATTGACTTTGTTAGGTACACACACCCCTATCCGGAGCAGGTTTCTATCAAGACAGGCAGACAGGATCGCTGAGCCGGGTGTATATATTCTTATGAAAAATGACGCATGCACATGTCC
ATTTCTTGAAAGGGAGAAGGCCTGAAGCCCTGAATTGATTACTTCATGTGCACAAGCTAGGGACCGATTCGATCACCCAACCCAGCAATCTGTCAGCTGTCTTCTCTGCACGCTAACTAC
TCCCATCACAATTCAGCGCCTCTCTTGGCTCGTTTTTATTAGTTAGGCAGTCAATTCGATTATCTTATCTGAGAAAGTAATTAACCCTCGCGACGGGCGCCCAAGTGTCCATATTCGCAG
TCGAACGAAACCTGCTAGCGACGCGGAAAAATCGAAAGCAAACGGACGCACAAGAAATCTACTCCGTTGCTAATGAATCACAGGGAAGCACCTGTGTTTGCGTCTCTTCTCATTTTATTT
CAGAATCCCGGCCGTTTGGCCGGTTTCTCCTACCAAACGATCGCGAGGCTCAACTCAACGCAGCACCTTTTCGTTTGGTATAGGAGGAGTAGGTGCTACACTGGTAGGTGCGTGAGTTCA
GTTTGGCAAAGTGATCGATCGTATCTGCTCGGCTCCCAGTGCTTGTGAAAGCTGCGGTGTTATCTGACTGGTAGTCCGTGCACGTCAACAAATAGACTATCAGCACATGTCCACGCGATC
ACGCAATCCGACGACGAGATCGGGCCGGCCGGCATGCACGCTGTGCCCTGCGTCCTTCTAGAATTGCTCCGGATTCTTTCCTCGCGAGCACTTCATGTGCTGCGCTACGCCTAGCATCTT
TACATGTCGAGCGGTCGAGGTGCCCTGAAACCAGCTTGGTCACGCTAAGGCGTGTTCTCGTGCGTCCTTGCGAGGAGGCAGAGAGGCCTGAACGAACTGGAACAGAGCAGGAGGTGCCGT
GCTCCTCGGACGACATCCGGTATGGAGGTGCGTAGTACGTCCAGAAAGATTAGTTTCTGCCATACTTGTGGGCACAGGAACGCAGATGAGATGGCATCGATGTTTTGGGCTCAAGGCAAT
AAGTGGGGTTAAGGGCCTGTTCGGTACACACTAGTCCTGCGAGAATAACTGAGAGCATGCTCGTCACTGCAATACCTTCTTTTTCTTTTCGAAAAAACGACCGGTGCAAAAGATCGGCGC
CGAGCACCGCCCACCGCTGATGCATCATACAGGTTTCCTTTTCTGAAAGACCTGCGGCGGCGCAGACGACCGCGTGGCACGGCAATGCTGGACTCGCAGGCATGGCTAGTGGAAACTGGA
AAAGGCGCCATCCTTTTTCTCATGTGACCCCGGGGCCACTCTCGACCGTGAACTCATCAAAGGCGCAGGCACACATATGTGTGTGTGACAGGGGGTGCGTGGATCAGCAGCGGACGATGC
CCACCAAACCCAACCGAACCGCGCGCCTCCAGCCAGGCAACGCACGCACGCACCCCGGCGCCCCTCGTCCGCTCGCTTCAAACCCCCAGGCGCCAGCCGAGGTCCACTGCTCCACCCACC
CAAACCTGCCTGCGGCGGTGAACAAAAGCGGCGGCGGGGGCGTGTGCGCGTTGCCATCACGCCAGCCTAGGATCATACGGGACGGGACCCCTCGCGCCCCGCGCCCCCGTCACCACTCAT
GCCCGCCCCGCCTGCGCGTGGCGATCCCATCCACCGTGCGCGGCGCAGAGGCTCGCGCAGCCCGATCGGACAAAGGCCGGGGGGAGCCCACAGCGCACGAGCATGCGGCTGGACTCGATC
AACTGCGCCTTCGACTTCGAGTAAACAACTTCATGCGAGGGGAAAGCTCGCTCGAGATCTACAAAGCAGGGAAGGGTTACACGGCTCACTAGAGATCCAGAAAGTACAGTGCGTCGTCAC
ACGAGGGTAGCGCGGATTAGGTGGGTAGGTTATATTTGTTTCCTGGTGACGGTAATTACTGTAGGACCCACCGTCTGATGCTAGCGTTTAGATCGGACATCCGGACGCTAACAATCGTTT
CTTTTGTCAGCTTTGGCGTTTGGACCTTTGGTTGCTCGGTCAACTGAACCGAATGGCTCGCACTCCGCAGACGGTGAGGGGAGGGAGGCCAGAAGTAAAGAAAGTTTGCCGGCGCTTGCG
TGCCCGTGCAGGTTGTTGATCTCATGGACGCACAGAGACATTGCACGCGAGCCTTCCAAGTCACAGCTGGCGGAGGTTAAGCCGTCCCCGGTTAGTTGCCCACGGTAGAAATTTGGCCAT
ACAATTTGTGTTCGTGATGCAATGCAATGCAATAGAGAAAGACAAATCGCAGGGGCTTTCGTGTGCATGCAGTTCGACAATACTCGCTCCAACAATGCAATGCAGAAAAAATGGAACTTC
TGCAGAATTCCTGTAAACTCAGCAGGGTCGGTTTCAGCTAGCTGGGTTAGGTGGGGAAATGGAAAGAAAAGGAAACAGAGACCTAGCAGGGGCTAGCCATGTCTGCACTCGTTATCCCTT
GGCCCACCGCTACATCGAACCCCAGCATGCTTGTGCCAATTTCTGCCTTTTGAGGTGTTTGCCTGCCCAGCCAATCGACTGGCCTTCAACTTGCAGGCTTTGCTTGCCCCTTGTGTCCCC
GGGCAGGCAGCCTCCCCCGCAAAAGGGTTAGAGGACCTACTGTTCTGGAGTAGTAGCTCATTGCTTTGTTCTGTACCCCATCATGTTAAAAGAAAATTGTAAGAAGAAAGAAATATTTCT
TTACATTTTGAATTGCAAAAGAAAATTCGTGCCAAGCGCGATGCCGATTTGAAATCTCAGTGCAAATAGCCGAATAGGTGATTTGAGTGTGATTCTTGGATATCCCGTCTTGGGCATCAA
TTTGTTTAATCGGTCATACTAAGTCGAGTTCGTCATCGGACAAGAAACAGCAAAGGTGCAAGTTTACGTCAGTCGAGCAAGAAGCGAAGTGAGGCTGGCAAATGGAGGTTTCCACTCTAT
GATTAATCATTTTTTTTAAAAAAAAATGGCCTCAATCTAAGTTGACAATTTCTTTGCGGAGCTCACTTATGGAAAAAATAAGTTCAGAGTGCGGTTCAGAAAAAAAAACACTGATGATTT
CAGGCTCTAATCTGAGTTTCTAGCAGGGGCATTTCTAAGCTGTCAATTTTCTAGGTACCATCACAACAAGTTTTAAAATGCAATGATTTCACAGCAACGTTACAGTAGAAAATCGAAACA
GCCAATTACCAGTCAAAGCCAGATCCTCTCAAGAACTAGTATCTTCAGAAATCACCTCGTATTCTTTTAAACAGGGCCAGAAATGCTCGTGACATGTCAGCATGACGTCAGGGCTTGGCC
AATTCCAAACCTTTCCGTCCAGTCCCAAAACTGGGAACCAGGGAACCTGCCCTGCAGGCTGGAACACACATCGAGGCCCCCAGGCCAGGCTCGAACGGGGCATGATGGCCGGCATCATGG
CAAGCCGTCCGGGGTCAAACGGATGCGTCCAGAGAAAGGCCTCTCCTCTCCTCTCTGCTGCCAATCTGCTATCGGGCCATCACCATTCTCCACCCGGATAGTGGCCTCACCGCGCAGGCT
CGCGGCAGCCAATCATCCGGTTCACCACCCCATGCGGCCTGATGCCTTGAGGTGCACAAGTCAATGGCATCATTTCCAGTTTTCCACCCTCGCCTCTCCTTTTGGCCCTCCCGAAAAGAG
GCCCCTCCTTGGGGACACCGCGAGAAATCATGAAGATTTCCGGAAGGTCGCTGCTTAATCCTCTTTGCGATCCTCCCGCTAGACAAACAGGATTATTTAGCATAAAACAATGGGGTTTTG
GTCAACTGAAGGAGATGCGCGACTGAGGGATCGGTTGCACACTTGCACTCAACGGTAGCGCGTGGTGGACATGCTTGAGACTTGGGTTTCTTGCATGTCTTAGCATGTTATTGTATTTCA
CTGCTTCCTCTTATCACAAGTATAACTTTTATTTGTCTTTGTTTTAAGGGAAGGTTTTTTAACTTTAGCCATCAATATCTATATCTATAGAAATGTATTATTTTTATGAAAGAGNNNNNN
NNNNNNNNNNNNNNNNNGGCAATGCATACCAATGAGGCTTCTACCAAGACTTTATACAACACATTTCCCACAAAAGAGCAAAGCATTCGCCAAACTTATTACATTAGGTGCCTCTTCAGA
GTGCATGCTAAGTTTGCCATAAGCCCATAAGTGATCACAATTTTTCCAATGTTTGGTCGTTGCTACAAGCCCACAACTTTGTTTATCTGACTTCTTAGTCACTTGGCTCACTTGACATAA
CACGGATTTTCTCGTTTGATTTTACCTAAGATTGTTGATTTTTTTTTTTACCAAACAAGTATGCCGCAACTAACTTTAGGAGCACTGGGCAAAAATGCATGACAAACTTGTGATATCATC
CAAACACGCCGTAGGACTTGTAGCTCACAGTGAGCAGAGTGCTCCCTCTTTTTGATAGTTCTTTTCCATTGTAAAATCTAACATGATCATTAAAACTAGAATTAACCTCAATGGTGCTAA
AACATATGTGCTTGATCGATCCCTTCTCTGTTACTGTATTCTATTCTATATACAAACATTCGTCCCGTGTAAATTTTTTCCCCGAATACATGCTACTTCTCCTGTGTGTGTGTTTGTGAC
ACTGAAATGAATTGGGGGTCCATGGGGAGGATAGACTAGACAGTCACATTAGAGTACTTAAATGCGGCCGAGCTGTCCCTTCCCTCCCGATTTGGCCCGGCATTTTTGCTGCTAAATTAA
TACAATAATGTCCCCTTTCCTTTGACCTCCTCCTAGGCATTTCGCATGCACACCCCGGCCTTATTCGTAATTAATCACTGCCAGAAACTGTTGTACTTTCCCAGCTTATCTCATCCAGAG
ATTCTGCTGAAGCGTATCAACGGACGGATTTGCTCCAGGTACAGCAGCACAGCCGTGGACGAACACTGAACAAAAGATTTCCCTGACCAGAATATATTAATATCTCAGCACAGAGTATAG
TACCATGCAATCTCATGCACAGAGTAAGATTTTAATGTATATTTTAGGTAGGGGGTAGATATTGTTTTCCGAGAAAAAAAGTTCAATCTGGTTCTACAAAGAATTAAAGTACACTTGCTT
GTCAAGAAAAATTGAAAGTTAAAGATCACTTTTGAAAAGAGGATATCTTGCCAACTACAAGTAGGCATTCTTGCATAGTAACAGTATATGGGAATGAAATTCATATGACATTTTTTTTGC
AATGATTCTTATATGGCATTTAACATGTGTTTTCTCTGTTTTTCTTGGCTCTAAGCTACACCTTCCATTTGGCTATATAACACTCCATTTTTCGAATGACGGTGCAGTGCTCTAAGAGAC
TAAATGCTTGGTTTCAAAAAAAAAAAAGACTAAGTGTCATCTTTGGTGCCCACTTTTATTTTTTGACTAAAAGTGGGAATTCAGACTAAATATTAGTCTGAGTCGCCACTTTTATTTTTG
GACTGATATATCTTCGTAGATCATCACCTATGCTATGGTGTATTCTTCCCAAACACAAAAGGCCCAAAAAAGATTATAGGCATTAGTGCATATCTTTTTAGGAAAATCCCAATGAATGCT
ATACGTGAAAATTCCTTTCCTAATCAATGTACGAGAGTATACTCATTTGTTCTAGTAGTAGCATATAGCAGCGTTGTACTACTTTACAAAAATATTGTGTTTTAGCACCTTACACTTCGG
TGCCTCAAATATCGAAGAACAATTCCTGGGTACCTAGAACATTTACGAAAATCAACCCAAAACAATCAGAATGGCACACAAGCCTACCAAGTCAACCAGCACGCAGAATTCCCTGGACTA
AATAATAAACCGACACCTGCACATCGCGCACGGTCCACCACACCGCTTAAAAAATTTCGCAGGCCCTTCTTCTCGAAGCGATCCACGGCTTCGTTTCGTGCACCCCGTCGAGGGGCCTAT
TCGCAAAAGATCCACCCCCCAGCGCATCAAATTTATTGCACTGCTCTGCTGCCTCTCATGAATGGCGTTTATTTAAGTCTCCACCCTCCGCTCCGGGAACTTCTTTTCTGCGGAATTTTT
TGGGTTCTCGGGCTCCGCCGCGATCCCATCCTCGCCTCGCCGGCCCCCCGCTGCTCCCGGCGGTTCTCCCGGAGCTTCCCTTTTGGCCGACGCAGCAGAGGAGTGAAAGAGAATTGCGGC
GGCGGCGTCTTCCCCGCTCAAAGGTCAGAGCTCCCTGATCCTTCACCCCGTCTTGCCCCCTACTCGAGTTCTCGGTCTTCTCGTGGTGTTGCTCTTCTTCGTCCATGGCTGGTTCTGCAT
GTGCGTGAGGAGTGGAGGAGACTTTGCTTCTTGCTTGGCCCTGTTCATCTTCCCAGTTCGTTTTGTGCACACATCCTTTTCGTTCATTTCTTCAGAAACTCTGATCTGACGAACCGGTAG
ACGAGCGATAGAATCGCTGAGGTAGCATTCGACAGATGCGTATTTCATGATTTCGGATTGAAGACACGTCCTTTTTATCACCAGAAAGAGAGGAAAATGGGATCTTTAACCCCAAGCTTC
CTCTTGTTTGCTACACCTTGCCTCCTTGGTGTGTTGTTCTTGCCTGCCTGCACGTAGTTACTCCACTGGGCCGCACAGTCAATTACTCCGCCTTACCGACACAGTCAGATGTGGCGCAGT
TAAAGCCCTGCTACCGGAGTCCCCCAGTTCCTCCGGGCCCTTTGCCAGCTTCTTGAGGTGCTAGGATCGGTGGCGCGCGGCTGCTGGTTTCGCTCCTGTTTCCCCTGTTCATCCTCCTCC
TTGCTTCCTTGTTCCTTCCGTGAGGAGAAAGGAAGAAACCAGGAGGGCGTGCTCGGGCTCTGATCCAACCAAAGTCATGGTCCTCCTTTGCTTCGTCGGGTAGCCATTCTTTGTTCCTTT
CCCTGTCTCTGCTTCGACGCGTACAGAAACCTGCAGTTTTAGTTTTAGTATCCGGTGCCTTGTCTCCTTCTCTGCCGTGTTGTCTAGCTGTATGTGTGTGTGTACACTGAGGCTGACTTT
TTTCTCCCTGGAAACACCCGATGTTTGGTGAGGCGCGAAATGAGAAGGAGTTGTTGGGCACGCCGGTCGCTGCATCTGCCTTTGCTCTTCAGAGTTTCTTTCCTTTTGAGCATTATGTTT
TTGCGAGATGGTTTCGTCTTTAGATTTCTTTTTCACTCCTCTTTTTTGGGTGTCGCTGAAAGGGTGTAAAGCGTCTGGTTCTACCAGGACGCTGCGAGACTTTTCCTCCCATGGGAATCT
AGGTTACGCGAAACACGGCATTTGTTTGTAGATAGATGGACATCGGCATTAGCAAACGCAGCTTTTTGTCCTCCATTCTGGTGAACAGGAAGCATGCACTTTTTTTCCTGGGTCGATCGG
CGGGAGTATTTGACTTCTGAATATTTTTTGCAGGAAATAATCAGCATATTTATCAGAGGCAGCTGCTGAGGCATGCATGGCTAGGACTTGAGGCCTTGAGGGTACTGTATGTGCAGATCA
TGAAGATAGGTAAGTGCGGTTGGTCTTTTGCTTTTTACTCTGTATTCGCAAAAGCATTTGCTTAATTGCATCAGTTAAGCGTGGCAGTGTTCTGATTTCTGAGGTTCTTGAATCTTGATG
GTAGCCTGGTTTTAGGCTGTAGCGAAGTTTTGATTATGCCTTCAAAGGGTAGTTTCTAGATAGAATGATGCATTTCATTTGATAGGCTGTGGCGAAGTTCTGATGGGTTGTTGTATGGTA
GAATGATGCATTTCATTTGATAGGCCTACTGAATTCACAAATGTGCGTTGATACACCATGTGATTGTTAGAACCCACCACATCATAGATAATTTTCTTTCTGATTATGATTATTTGTGAA
ATTGTCACATTCGGCAGGCAATATGTTCCGAGGTAATCCGCCTCAATGTTATTGGCTTTCAATGCCTGTTATGTTTCTGTTGTTTTATGCTTTAATCCTCATAGAAGGATCCATATATGC
CGATTTCCGTCAGCTTTTATTTAAACTGAAATCGTTTTATTGACTTGATTGTGACACATAAACAATGCTCTATTCGTATTGAATCCTGATCTTTTATTTGGTAGGAAGACTGTTGCTTCT
TGGCTTTTGTTCCTTCAGGACTACCAACAACATCTTAGACAAGAAAACAGCGTTTTCCAAGTTTCTCTATGACAGAAACATTGTGCATTGAAGATGCTTGATTTCAGAGTTGTGAGTCAC
TGCAGGAAAGTTTAATGCTTACATATGATCAAAGTGACAGTGCAACTAAAATGAAAGAGAAACTTTAGAGGAACTTAGCCAAAGTTCCCTAATGTTAATTCCACCATAATGACTTTTTTT
CCATATATATCTTGTCCCAGTTGGGTTGGTCATCAGTTACTATAGTTTAGAAAATGGTCATTTGTTTACTGTTCAAACCAGAAACCATAAATGTTGATTATGATAGTATGTTTCCTTATT
ATTTTTCTTCTCTGTTCACACTTTTAATGGATGATTTTGGTATCTGAATGCAGATGATGAAAGGCCTTACCAAAGTCATATTTTTCAAGAGCTTCCATCCAATGGCAATCCTAAATTAGA
CTTCGAGACTGAAAGACAAAGTAAGCACAAATTTTTGGCGGATAAAATGGTTGAACAAACCAATCAATCTGAACATAGTTTTCTGAAGGGTGAGCATCAGAATGGAGGTAAAACCGGACA
GACATGCATTGAGGATTACTCGTATGACAAGGATGTTGTAGAGATCAAACTGCCGGACACAATTCTTTCTTCTAATTACGGTGGCCATTTTATCAAGGATGTCTGCATTGATGAAGGAGT
TCTTCCTGATAAAAAGACTTCAACAGAAAAGCTAGTAGATCAAAAGGTGTCAATAAACTTTGATTCCTCAGAAGATACAAACGGTGACCTAGGGGAAGAGATAAGAGCTGACTCTACAAA
GACTGCACTTGAATTAAAATCACATATAGTTATCCTACCTGTCATGTGTGCTACTGACGGCAATACTGGGGAACAAATCTCCCTATGCAAAGAGCACGATCTTGAAGGCAACAATACTGC
ACCTATATCAACCGATTCAAATGATGAGAAATCAAATCCCAAGCAATCACTGCATGAAGATGCACAAGGTGGCCAGCAGGTTGGCAGTGTCATTTCAGAGAGCAATGAAAATCTGGAGCC
ATTCTTCAATGGAGAAGCAGCTCATCAGGTATACTACTATTTAACTTACAGTACAGTACATTTGCAAATCATCTGTATGATGACCACTTTAGTCCTTAAAATTCGTTCTTTCCATTGATG
TGTCTCTTAATTGTTCGACGATTATATATAAGCTGTTAACTTGAGCGAATGTTGTATTTTTTTTATTTTCTATTTTCTGAAAAATGTGATTTAGCATTACATCTTCAGTTTATTTGATTC
AATAAACGAGGAACTGCACATATACTTTTCCACTATTTCTTCACGTATATACCATTACATTAAAGCACATAACATGATTGATGCCGTTACAGGATTCATTTAATGGTTGTCATGAAACTG
GAATTGGTATTGCATCGGAGACCAGTAACATCATTCACAGTGATTTACCAGCAGAATCGGCTGCAGCTGATTTCGCGGTGGCAATACCTGACAGTACTGCATTGGATAAGGGAGCATCCA
ACCAAGTTAATCACTATAACCCTTTTATTGCCTATGGATCATTAGACGAGACATGGGAACCTAATTACTCTCTCCCTACTATTGTGGATGCCGCTTCTGTAGCACCCATCTGTCCTGTTG
AAAAGACAGATAGTTTTAGTGATCTTGTCAACAGAGCACTGGAAGGATTTGATCCTATTGAAATAGATGAAGCCATAATTGAAGAGAATAGGTCAGATTCTGTTGAAGCAAGTACAAGTA
CACTGGATGTCCAAGCATCTGAACAATGTAATGATAAGAGAGAAAGTCCCACTGATGATGTGAAAACTGATGTAACACAAGAAACGGGTATAGCAGCTGTAACTACGTCTCTGTCCACTA
GCAATGGAGAGTCTAGTGATGTCAAAAGTGAGAATGGTAAAAAATGTGAGATTGATAATGCCCAGGATATAAATGATTTTAACCCAAGAGATGTGGAGGTTGGCACAAAAAGAAGTGAGG
ACATCACGGATAGTAAGAGTTCACCTCTTGTGCAAACAGAATCTGTGGTTCAACAAAATGGACCTGATAGTGCAAAAGTGACTGCACAAACTGTTATTCGTAATCCCTTTGAATCAAGCT
TCTCTGGTCCTAGCATTACGTCAGGTCCACTAACACCCTCTGGTCACATACCTTATTCTGGTAACATTTCTCTTCGATCAGAAAGTAGCACGACAAGCACTCGGTCATTTGCATTTCCAG
TGTAAGTGATGAATACCAGATCACTTTTGTTCAAAGTAGAATTGCTTTGTACCACTTCAATACTGTCGCTTAATTCTCTTAAACAAATTAATTCCTTCCCTATGTACATCTGTCTGCCGA
AATTCATAAAATCTAGCCCCATATAATATAAGCAACTTCATATTTTACTGTACATCTGAATGGACTAACATTGAATTTGTTCTTCTGTTATGGTAAATAGTTAACAGCATAATTCCCCTG
GCTAAAGAAATATCAGTCAGGCATTGATATAATTTCCTTAACTTAATTGTTATGGCGTAACTTCCTGTACTTGTCTGTATAATCATGAGCTCGTAGTAGTTTCTGAACCTTTGGACCAAT
CATGACATTCTTCATATATGTTATCTTTGTATTCGAAGCTATTTTCTCAAGCACTTTTCCTTTTGTTTTCTAATTCACAGACTACAGAACGAGTGGAACAGCAGCCCTGTAAAGATGGCG
AAGGCCGACCGCAGGCGTCTGAGGGAAGACCGAGGCTGGGGTTACAGAATCCTTTGCTGTAAATTCTGAAGTGTGCTTGCCCCTGTATTCTTTTTTGCCTGTTGATCAGTTGAGCCCTTA
GTGTCTGTCACGCTTGAGCCCAGCCCTCGGTAGTCCATGTTAAATTCATTCAAATATTTCTCTCCTTTCTCCCTCCTCTTGCTGTCTGCCCCTCCTCTTGCCCTGCTGTTCTTATTTATC
TCTAGCAGGCTAATGGCTTGTCGGATTCGGTAGTGGCTTGTAATTTACGACACTATGATGAGTGAGGAATGAAGGTATAGCTTTGATATAGCATTTGCTGTCACTTGAAGTATTATTGTA
GAGGTACTGATGTAGCTACAGGTAGAGGTACTATTGGACATGGACTGGTCCTTGACTCCAAGTATGATAACAATAGCAGGCAACAGAACTACATGACCGTAAATTGGTGCAAACACATAT
GTAAATCACTGAATCTGTTACAAACACCTGCAAAACCTGATACTGGTGCAGATGTATATACTACATGGTATCTATCCTCAAGCATGAACACCAATGACAAAATTGCCCATCTGCACAAAC
ATGAACATGATTCATGCTATTGCAGTCAGGGCTAAACAGGTTGTTCCAGCTTGGAGGCTAGATTAAGTCTGGCCGGATGGCATTATTCCGTATGGGCAACTAAGTACACTGACCCTCTCG
GCCCTCCTAATCACCTAGGACTAGCAACTAAACCCCTGAAGGAGCTGCTAAGCTAGCTCTCTAACTACTAGTATATGTACCGATCGAACTAGCCATGATGCCCCAGGCCCAAGTGCCCGG
GAGAAGCTCAGCTATGTCTAGGGCTTCTTCACCTGAAACCGCGTGGCACCGTTGTTGATCGGTCGGCGGCGGCTCGCCTTCCACGCGTAGTCCCGCCGGAGCATGTCGTACATCTCGGCG
GCCGCGTCGCCGTGCTTCCACGCCGCGCGCATCTTCACCGTCCGCGGCCGCGAGCCCGCTGAAGCCGTCGCCGTCGCCGTCGCTCCCGTGGTGGCTTTGGTTATTCCTTCTTCCTTGTTC
GCCGCACCAAGCTTCCTCCCTGAGAATACTCCCTTGTTGGCAGCAGAATCATCGGTCGACGCCGAGGCCAGCACCTTTGAAAGGTTCTGCTTGCAATCACCCAAGTATTATAGTAAGTAC
TCAAGTATCTGTCAGTGGATTTAGTTTGCTTTGATTCGTGAACAACGAACTGTGAGATCGAGCAGATTAGACGCTTCCACTAACCTTACTATCTCCTCTGTTGTTCACTCCATCGTTTGG
GTTCAGCACGACAACTGAAAGAACAGTGAAGATGGACTCAGGCACTCAGCAATGGATCAAGGCAAATCTCAAGAACATCAGCCAGCTGCGACGGCAACGAGATGGGCAAGAAAGAACTCA
CCGTGGCGAGCAAAGGCGATGGGGGCGTGCAGAGTGAGCAAGGAGACGATGATGAGCAGGACAAGTGCAAGAAGACTCTTTGCACTAGTTCTTCTGCGGCTCATGGTGTGAGACTTCGAT
TGGTCGCTTGTGGTTGGTTATTTGTGTGTAATGTGCTCTCAGTGGCAAGCTAGATAGGAGGAAGGAAGTGCTGAAGAGAAGAGAGGAAGCAGGGTGGGGGGTTGTTGGCCTTTTATAGAG
AGAATGCAATGCGCCAATGCTTGCAATTGTAGGTGGTACAGCTAGCTAGGGATCGATGGGGTGGATGGATATGCAGTCAAAGCAAGCCGAGAAAAGGACCGAGAATATCTGTTCTAACCG
TACTCCCGTGGTAGTTTTCTTTAACAAACCCTAGGCATTGTTTTATCGACTGGTCCTGATTGGGCCTGACCAAGGTATCAACACTTAACCCAAGCATCCAAGAGACTTTCAAGTTTGAAT
ATTTGTATATACTAGTACATACTCTGCATATTTCATCGTGTGTTAGCAAGGGAACTCACAAAAGGTTGACAGCATAACATTACACACCAATTAGGCAAGTACAGATAACTTATATGATTT
TCTCTTAAGCCAAAATTAACGTATGCTGATGAGATGCAACTACTGTATACTCCCTCCATTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNATTTTTTTAGATTTGAAAATATACGCTAGGAGTACGCATTGCATGCCCGGGCACCGATCCGGCTGGGCGATGTGTCGAGGTGTGTGAAAGCTCGAG
CTCGAACTGAATCCACTACTGGCAAGTCGTACACGTATAGAGAGTGTGAACAGACATTGCCTTTCTCGAGATTCCTAGCTAGCTAGAACGGTAGGAGTATGTCGTAGCTTAACTCAACGT
ACGTGCCGAGAAGAATGCTCGCTTCGCTTGCTTACAGTCTTCCATGCACGCGGCCGGCGAGGGCGAATCCCGTCGCGCCGGATTCTCTTCCCGGCTTTTACTTGGTCGAACGTCCGCCGC
CACTCCGCCATGCAGTTAGCTCTTCGAGATGCAAAAATGTCGGCAGCAGTCGGCTGGTCGGTGCACACTGTACGTGCAAGTTCATGCATCAAAAGCTGCGAGTTTGGATTCTGAACTCCG
ATCACTGAACTGATCGTTCACCCAATGATTCAGTTGGAAACGTACGAAGGTACGGCTACGGCTGGGTACTACGTGCACACTTCACAGTACACTACGATGAGCCATTTATAGCTATACATA
CTTATGTAACGATCGATTGGACGAACCCATTTGATGGTTTGAGGCCCCAGAATTGATCATCAGATTGGCGGACGTATGGTGTTCTACTCCTAGTGTGATCATCAGATTCTACCCCTCGCT
CTCGCTGTTTAAAGTACTCGACACCTCCTGCCCTGCTTCTACCTTTTCTTTTTACCACTGGTGACCTGGCGGCAGCCCTCGCCCTCTGAGGTTCGGCCAGAGCACGCACGAGATGGAGCA
CGAGGGCGTTCTGCCCCACGCAAAGCCCGGCCGTCACCTTGTGCGGAGTGGTGGGTGGCTTTCGGGAGCCGAGCTCGCTGCCTGTTGGTGGTGCTGGCAGTGGCAGCCGGGGCCGCCCGG
GCGACGGAGGCGCGCGGCAGGCACGCAAAGCCGGCGTGCACCGTCGCCAGGCAGCCACGTGCCGCTCATCGTGCGGCGCGAACCGCCAATCCCTGGCCGTCAAAAAATTACGCGCTCCGG
CTCCGGCGGTAAACAGATTCCCCAAGTTGTACATTGTACTGCCGCGGCCTCAACCACGCACGCAGCCGGCTCCATTTTTTAATCTCGGGCAGGCAAATATGCTTCGTCACAGTGCGGACT
GTGGAGAAAACGCACTGTAAATTTTCGCCTACTAGCTAGATGCCTCTCGTTCTTCTTCAGGTTTCAAAGTGGCGAAGTCCAAAGGCAAGGTTCCGTTCACCGCGTGCATCTTCAGTCAGG
CGGCGCCGCGGCGGTGACAAAGTTTCAAAGACCTGCAGTCGTAGCTGCAGGAGTTTCAGTGAAGATGCCGCATGTCTTTGGAGTACCTGGCTCTGGCTGGGCTAGACACGCAGGCGTGAT
CGTGTATTTAAACCCGACCTGCAACTTGGCCAGGGCGTCGACACAATTTGGCCCCAGGATCGTATCTCGCTTAGCTAGGATTCTAACAACTGCTTAACGTGCGCGCATGGATATTAGTCA
TTCGACATTTCACAATATAAGATGTGGTTTGACCCGTGCGACGCCTTGGTTTCCAGGGAGAGCGGTGGCGCTGCGCGCGCTTGAGTTTGTGAACATAGCAGGAGCTTGCAAGTTACAACC
TGAAGAAATATGCAGTTTGCATCTCTGAACGATGCTTCAGTAATTATCATTACTAGTCAGGTTGGAATGTGCACCTATACGAAACATGTTAATCTCAAATAATAATGAAATACGAATTTG
TTATCTTACTATGCTCAAAGTAGCATCGCATCGATGCATCAAACCAAATAAAATAGATAAAACATAATCTAAAATCAAATTGATTGCATCCGGTATTTAATTCAAACAATTATTTATCGT
AATGGTCATTCTAATACTTTTTTCTTAGGAATTTACTAACTTTTGGGTGTTAGTAGATATAGCCGATAGATTGACGTACTATGTTACACTGATTCTTAGTTTTGATAGAGGTAAAAGATT
AAATTAGCAATAAATGAATAATTCAATCATATTTTGCAAGTTGATGAAGTGAAAGCAAAGTTCAAATAGTAGTAGGGCTATCACATGTGAACATAGTATACAAAGTTTAGNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTTTCCGTACCAGAAAAAAACCACCATCAATAATTTTTTTTAAAAAGATTATGGGACCCACTCAATGTACCGTGGATCCCACCAAACAATA
TGCGTCTCCCACGAAGAGTATGCAGGTCCCGCTTGAACAGTGGGCCTCTCCTGAAACTGCGTGAGTCCCACTTGAATGGTTTGTGGGTCCCACCTGAAGGGCCAGGATGCATGAGATTGC
TCCAAACCTAGAAGCTTTAGTATACGTATATAGATTACTCTTCCTGCCCTTTGTTTAGTTGATTTATAGAATACAACAAATTTATCTACTCCTTTATTATTTCGTTACTATTTTTTTTTT
GCCTAGGATCTGGTCCGTGGCCTGGTTTCCTACCAAATCTTCATTTTGTTTACCAGTAGATCTTTGTATGCTCCTTGTCTATCAATAGCATAAATGTATCTTGTTGTTTGAAGTTTCAGG
CTTTCCAAGATGTCGGGGACCTGCGTTCTGTGCAATGGTGGAGCTTGGCCACAAATTCAGAGGGACACATCTTCACAGTGTAATTTGGCGTCCTAAGTATTTTGTGTCGTCCAGCTTCTC
TGCACTTCCACCTCATTGATATTTTCTTTGCCCATCTCCACAGCTTCACGGCCTAATTTGGTGTCCTAAGTATTCTGTCTCATCAGTGATGTGTGTGTCATTCAGCTTCTGAATGTGATC
CCCTGATGACCTTGCATTGGGTGTCCCGTTGGTGCTCATGCCCAGTCAGTGCACTTCCTGTTACCGCGTACTGATAAGTCCCCTATCTGTGTATCCAGCGCTCAACAGCCTTATCGCAAA
AAAAGGACATTTCAGGTCTGAGTTGGAATGTAAACCTGTTTCTTTTGATCTGCCTATGTTTGCTCCAGTTTAAAGGTCGGGCAGCTGGGAACTATATATGCCACTTAAACACAACTTTTT
TTTGGTTGGATGCAGTTTGTTGCAAAAACTCAAACTCAGGCATGAGCTGTGCTGTAAGAATCAAAGTGTCTTGGTTTGGCCCTCAACGGTGCTCAATAAGAATGATCATTATAATTCAAA
CATGATGCAATTCGCTGATGTAAACATTGGCTATTTAAGTTTGCTCATTACTGGAACAATCATATTGGATAAAAAAAAACTAGGTCCGCTAATATANNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTATATCATTTGAATCTAAAAGTTGGTCATACCTGCTCTTCTT
ATTCTGATTCCTCTTCTTTTTATTTTCATTGGTATCTTAGTTCTGCACTGAAAAATGCTTCATGGTGAGATATCTCTCTTCTATTGGATTCTCTAGCTGTATGACTCTTTTTTTATGGTA
TTAAGTTTTGTGGTACTATACGTCCTGTAACCATAAGGTAAAAAGCAACTCTTGATTTTCACAGCTATATAAACTGCTCGGTCGCTATGTTTTTATGGTAACCGTAAGTTGCCAATTCAC
ATTTGTGCAACCTCTATACGTGCCTCATATTGCTGTAAACAAAGCCATAACCTTAGCAGATTTTTATAATTCCCTCTAAGTTTTTTTTTGAAATATCGGCTCTTTCAAGTTGCAATTGGC
AACTAAAAGGTGGAATAATTATTCCGAAGCAGTGTATTTGAGTCAAGATGCCTGCTTGGCAAATTGGAGGTAGCAATATAGACAAAATTCAAACACGCGTTAATTTTTTCATTTCCTGCA
TAATATGTGTTGAGGGATCCTCTATTCTGTGTCAGTTATGTGCATCAAGGATACTTCGTTCGCTTATCTCCACTTACGAATTATGAAAATAGATGTGCTTAGATGAAATTCATGCCTGCA
CCCATAGCAAATGTGCGGGGTTCATCGTAATGTATCCAACCTTTACTCAAAGAATCAATTTGTTGATGAATATTCGGAAGCACATTAACTGGTCCAACCAATCATATCGGCTATTCATGA
TTAGCATTTGATCTGGCGCGGTGAACCACGCACAGATGAAGCGACGGCCGACCAGCCCTTGAAACTTTCAGAGACAATCCAGTGCACGCTTTCCACATCAGATCACTCCATTGCGTCATA
ATAGAACAGTGCCCATCCGGTCCATCAAGCCCATCTGCGCGTAGCAGGCGCAGGCGCGGCAAAGCGCCTCCCGTCCTAGTTTTACATGAGCCGGCCCACAAAGGACAAAGCCCAGCTGTG
TGTGAGGCCCGTAGAGCGAGCCAGCCCTGCCTTACTCTCTCCCACCTGCCTGCGCCGCCAGTGGCGCGCGAGAGCAACGCAAAAACCCCTCCGACCGCCGCCGCCGCCGCCTCTTCCACC
TCCCAAAGTCGCGACCCCTCACGCCCTCCAAGCGCCTGGTCGCTACCCCCTGCTTGCTCTCGCGCCAGCGCCATGGGGCGACCGACGGGAGGCGCGGCGGCCTCTTCCTCCTCCTCGAAG
AAGCAGAAACCGAAGCAGAAGCAGCGCGGCGGCGTCGACTTCAAGGTAACCCCATCCCGCCGATTATCGGCTCTCTTGGAGACCTAACTATAGCTCACTGTGTCGAGCCCTTTCCTCCGG
TTGCAGAAGTACAAGCACAAGGTCGGGCGCAAGCTGCCGCCGCCGAAGAATGCCACCAACACGGAGATCAAGTCCAAAGGTGAGGCCAGCCGAGGCAACCTCTTTTTTTTTTTTTTTGCT
TCGTTACCCTGCAATTCGAGGTTCCACGGTGCCCAATTTAGGATTTTGGGTCGTGAATTTATGTTGTGTGTGCGTCCAGCGATCGTGTTGCCGGAGCAGAGCATGGCCTCCGAGAGGGCG
GGCATGGCAGTGAACAAACGCGGGCTCACGCTGCGGGAGCTGCTGCAGCAAACGGCGCACTACAATGCCAATGTGCGGCGAGGTGAGCTTCCTCTAGTCTGCACGTTGACCCATAAGTTA
AAGTGTTAAACTATGATGCAGTCTCGTGGTAGCTGACTGTATCTATGCTGCTGCCTTTATGCTGAAGCTGCACTGAATGGAATCAAGGACATTGTTGTCAAGCACCCAACAGAGCTTAAA
CTGCACAAGGTTGCTATAATTGAGAAGCTGCAGGAAAGGATATGCGATACCGACAATGTGGTCCGTGAATCGTTATACAATATACTGCAGTCTCTGATCTTCCCATCTTTGAAACAGGTA
TTTTTGCCCTTCTATCAAATAGCTGGATTACCAAGAAATATTTTAATTGAAATTGTTATTTTTTTCCTGCTGCATGTTTACAATTCAGTTTTCTGTAAATGATCTGGTAACGATTGATCT
TGCTCTTGTGATATCAATATATCATGCTCTCTATTGACCACAGTGGCTATCGCATTGGCAAATACATCATAGAGTTTCTATCACTGTTTTCTGTCCATCCCAAGCACCATCCATCTGTGC
CTAGAATTGCCTGTTCCTTTTCCTATTCCAATCACCATGGAAGGGCTTCTAGCTCTGGTCCATTCTATTTTCTAGCTCTATGGTTTTGGCATCAGATGTAGACTACTTTTTTTTTAATTG
CAGGATAATGCTATATCTACAAGGAGTACACTGTTTCTGCTGATGGCTAATATTCTTAATGGAATGACCCATCTATCCATTGATATCCAGTTAATGGCTTTCAGAATTTTGGAGCTTGTG
GTTCTTAATTTCCCATCCTCCTTTCCTAGTTATGCTGAACAGGTAAGCGGGCTGCTGTGTTGTATTAAATGATGACACACATCTATTGTTCTTGGCAAATTATTTTGTTAAGAGATATTG
TATAATTGTATTGTTTAATCGGTGGTACTTGTTTCTAAAATTTGTATATGTTAACTACCAGAACTAATTTGGTACTCCAGCTTTCATCAAGTAATGAATATACACATTGGAACTGCTTCT
CACTCCTGCTAGGTATTTACACGTGTTGACCATATTCATTACCAGCTTATAGTTTTGTTTTCATTATTTTTTCTGACAGGTGTTCAACAACTTTGTTGTGGTACTGAGCAATGATAGAAT
CAACCTACATGATAGGAACAAACTTAACAGTGTCCTTGGTGGGCTTGGACACTGCCTTTCCTTGGTTGCTAAAGTGACAGAAAATGATGATACATCAAATCAACAGGTTTGTACAATGAA
CTCATCAAATTGTAGTTTACTTGAAAAGTTTCTTATTGACATATCTGGAGCTATGATGAAGAGCTTGGTGAAATAGAAAATGTACATGTTCTGGAATGCATGCCTACATGAAAGCCCATT
TTAATTATACTCCATTTATAGATCTTTGCGCATCACCTACAGGTTCATAATCTCTCTGCAAGGGAACTTTGGAAATGCACTACAGATGAAGACAACTCAGGAGGCAGTTAAGTCTTTTAC
ACTCTCTCTTTTGCTTTATAATCTGCTATGTACTTTATGTTACACCACCTTTGAATTGGATAAAATAGTAATTGAGTGAGTTGAATGTTTTTTGTTAATATAATCACTAATCAGAGGTTG
CTTGAACTTGAGAGCACAAACCACTCACATTTGCTATATTTATTCTTATTCTTATGGTAGTTCCAACTTTCTGGCCTTCCTGAAACGAATGACAGAATGCCAAGAGTTAAGCTTTAGCAA
AATACTTGATGTCTCTGTCAGTGTAGCACACTTGTTTTCGTTCTTACCATTGGATTGGTAAGTGTTTAATCAGGATTCAGGTTAGCTAATTGATTGTTAATTGCAATCGGGGTGGTTTCA
ACTCAGAAATACCAAGAAGTACAAACAGTATTTATAAAAATATCTCCCTTAAGGATCATAATATAAACAGCTGTGTGGGCCCTTCCTGATTCCCAGTCTCTCTTTCCTTTTTGAATCTTT
TTGTAGATGCGCACCACATTGTTAATGTTTTGATGTTATTTTTGGTTATGTCCTCTTGTTCATTCAGCTATATTATTGTTGCCTTATATACTTCTTCTGCACTGCAGGAGCATTTGCAAT
GCCTAATTTATTGGTGAAGCTTCAGAGCCTTGTCCAAATCCTCATTAACTCTGTAGAGGTTTCAGCCTCAGAGCTCTGTGCGAAGTCAGCTATTGATGCTCAGTCAAGTGAAGCATTGTT
ATCGGCCCTCCATTGTCTGGATATAATATGTAGGATATTTATTCATGAGGTGAAGAAACCTCAATTAAAATTTTCCATATCCAAAACTCAGTTTGGGCCTGACTGGTTGAGGAGCTCCCT
ATTGATACATCTAAAGAATTTATGGGGAGTGAAGCGATTGTTTCATGAAAAGGTAAGGTTTTATTGAATAAATTCCCGATCAAACAAAAGAGAATCATGCTAGTTTTATTTTTTCTCGTA
AATATAAAGAAATATGCCAGGTTTTGATTTGCTACACTTCGTTAGAGTGATTGCTTTGATCTAGGAACAGAGTACCTTTTGATGGAAATCAGGAACTGCAATATATGGATTAATGTATGC
TAGAGGCTCTTAGCTAGTGTCTACTGCTCACTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTACTATATTTGTATTGTGTTGTATTTATGTATAATTGCATTTGCCTGAGCCT
ACTCAAGATAAGCTTAAGCAAGCTCAGCCCAGCTGAGTTCAAGCATTATAAAATTTTATGTCCAATTATGGTTCAAATAGCTTGTTGAGCTTGAGTATTTTTGGTAGCTCTACATGTGTC
AAAGTTTTTCATGGAATCACTTTCGAGTTTGAGCAGCTTTTGCTTCCCTCTGCCCTATAAGCATACGCATTTCATGCACTGAGGTTTATTTTGCTTCTGAACTTGTTATTTGTACCATTA
GTATAAGTCTACGATGATACTTTGATTATGACTGCATGATTCAGCAACTATTTATCTGGACTTTGTTTCTGATGATGTGTTTGTTAACTTAGTTAACTTTCTGGTTCAAATATTATTGAG
CCCTGTTCCAAATTTGTAGCTGTGTATTCCTTGTTATAAAGTTCTGGGTGTCGAATATCTTTTGCATATAACTTATTACAAATTTCTTTCTCATGGCAGGGAGAAGACAAATTTTTCATT
TTCAATTTGAAGATTGCTGAAATCTTTCTTTACTTGAGTGCATGGATAGATAGCACAATGTTTCCAGCTGAAGAATTTTGCCATTTTGTATCTTCTCTATTCACAAAGGTTTTTCCTTGC
TTATCAGTTTTAGCTGCTGGCGGATGCTATTTTATGACCATCTTATGGATTTGCATTATTGATTTGGAATTGATGATGTTTTTTTTATCAGGCAAAAACACTTCGCAATAAGGATATCTT
GGAAATGTATTTGAGCCCCCTTATAACTTCCATACCAGATCTAATATTCAACTCCCCAGATGACTCAAAAGGATATTTATTGGAGGTATGGTAATTTGCTTTTCTAGTCTGTAAAACATT
TCATGTTATCACATTGCCAAAATAAAACACTTTGTTCAAGTGCAGGCATTTACAGACGCATTTAGAGATTGCAAGGTGGATTGCAAGCTAATCTTGCCATATTTGGATGCAGTTGGAGAA
ATGCTGCTTCCTGTAGGTGCCTTTATTTGACACTATGATATACTTTCCATGTACATTGTTAAGTATTAATTCCTCTGTATGTAAATGTATAGCATTTGAATAAGATTCATTCCAACTTTT
AAAAATTTGACTATTAATATGAGAAAATATTTCTAGACCGTAGATTTGACTCATCATTGACTGACTGGAAGTAGTTAGAATATGTTCTTCCCAAAAATGCTTTCATCACACTATGTTTCC
ATAGGTTTTTCTAATACATTATGATAGAGTCAAAGTTGGCTCTGGAAAACCATGCCAGGCCTCACATGTTTTTATACATACAACAGTAGGAAGTAGGGCTTTATGGATGTCTAGTGAAAA
CCATCAAATTGGTATGACAGACAAGTAACTCTGGTCCACTGATATTGATTCCGACAAGTGATTCTATGAGATTTAGCTAAAGGATAATAATCACCTAAAACTTACAAAAAAGAAGATATG
TTTGGGATCCTGATATATGATTTATAATATCTTCCCGTTGTCTATGGTTAGGAGAAAACAGGCATATGGCTTCCTGAAAATGATTCAGGCATGTTGGGCTATCAGGACGCATGGATACAT
GAGCTACCTCGAATTTTGCTAAAATCAATTGATAAAGCTCCCCCAGTTACAAAGGTTTGCTATGGGTTTTGTTATCCACTAAAAAAATGATATGCTTAGAGTTGGTATACTCAGGTTGTG
CATGTTAAAACCTTTCACTTTACTACTTTCTGACAATGGATTATTTTAGGCTGTTTTGGAGCTGCTTCTAAGAATTGGACAATACTTCCCCACAATGGACTGTGAAAACTTGCGTCCCTT
CATAAAGTTATTTGGTGTTGAATGTAATTACTACTCAACAATCATCTTATCATCCATGTTTATTTATCATTTTTTTTAATTCATGTCTTTTTACTGACAGCATCATCAGGAACTGTGGAG
CTTGGTCCTTTTGTTAACCTACCTCGTGATTGCCAAGAACTTGCCATTTCATGTCTTTATTACTTTCCCAGTCTGCTTCCTGACGTAATCAGGCCGTTGGCCTCATGTTGCTTAAGTAAG
CATTTTTGCTTAGTCTCTACTTGATTGTAGATCACTATATTTAATTTTATTGTTGTAAATTCTGGGTATAACCTACGAAATTCAGGTGATGTGCTGGAACCCCTCATACTGTTGAAGGTT
GTTGAGGTCCTACAGTCAACATACAAGGCTGGTGGTCTACAGATAACAGAGCAACTCAGTTTCTTGTCGCTGCTAATGGCAAGATTCAGAGTTCATCCTGGTGACTACTTGAACATCCTT
TTCCATTTATTACTGCTGTTATGCTGTCTTCTAGTGACCATTCAAACTTCGCTCTTAATTGATTGATTACCTTAGCTGAACCTAATAGTTTTATTTTCCTTTCTTCAATGATTATTATTT
TCTTTTGGTTATTTTAGCTGAGCATTTCTTCTCTGACAGCTGTATTTTACTTTGTTGAACTAGGGGGTTTAGTTACTCCAGAAGATCCTAGTAAGGTCTCAAATTGGGATACTTTCAAGT
TGTTGAATCGTATAATTTTAACTTCCCTATCTGAAATGGGTGATGGCTCGCTGGTCCTTGAATTGATGTGGAATAATTTATCTAATGCGATTGTGAGTTTTCTAAACAGTGTTTCTGTTA
CATATTTTATTACAACAGCCATTGACTCACATGTCACTTGCTTACTACAGGCTCAAAAACCATCGATGCATAACATGAACGGCTTGTTCAGAATTATTGTTACACTTGATGCAGGAACTA
GTAAGCTCATGAACGAAGATGTTGTAAAGCTTATTGCTGGCTACTTGGTTGACGCTTCTTTGGTGTGTACTTTTCCATGTTTTAGAGCTCTGATACTCAATACTTGGGTGATTTGAGCAT
TTTTACCCTTATTTGCTCCAACTAATCTTCAGGACAGGGAGGCATAGTATTTCATTCAAAAGCCCAAAAGGGTGGTTATGTTGACGCATCAGAGTATAGATCACAGTTTCACTGATAGTG
CCTACTTTGTAGTAAGAGTTAAAAAATCACAATTAGTATGTTATACCTAGGAAGTTCCAGGTTACGGGGCACTGAACACAGAACACCACTGATTTGTTTAATGGAACTGGTTGTAGATGT
TCCCAATTCCTTGCAATTGCTTTCTACTGTACACATTCGGTTTTGAGTAGGAATTGATCTCACTACCCCTGTTATGTTTTATCTGCAGGATCTGTCTAAAACCATTGAATTTGGTTTTCA
ACCTGATAAGACAAGATTATTTCAGTACTTTATCAAGCCTTGCACCATCATGTTTGCCAAGAATGACAAGGTTCTTTTCAGCACATTGGAGATGCTGAAATCTTTTGTAACAGGAGATGA
TCATCTGTTTTCATCTCTCTCCAAGTTAAACTACCCAGGAGAGCTATCATGTCGAATTTGTGTTGTCACAACCATACTCATCTTCTTATGCAATGACCGCAAACTCCGTAGGAATCTTTC
TTTTGGCAAATCAGTTATCAAAGGCATCCTGGATTATATAAGGCATCAGCTGGTAAGTGATGGTTAGAAATAACAGAAGTGGTTTTGTTTAATTGCCGTATCGATTGATGGTTTTTAAAT
TTCCTAGTGATCAAATCACTTTTCAATTTAATGGTACTTTGAGGGCATCTAAAAAAACAGAAATTATTTTGCCTGTGATATGTCAAATTGCCAATTGATTACATAGTTCCTAACTTAAAA
AAAAGATTGTTGATTTGTGCTAAACTAAATTAGTTACTTGATTTATCATGCCCAAATGTAGTTGTGGGAGTTTGGAAGATTACTGTCCGGAGTTCATCTAATTGTTTCGCTTTATGTCAA
TTCCTGCTGCAGGATTCTAGTGTGCCTAATGTAACATATGAAGAAAAACAGAAGTCAAAATCTGCTTTTGAGCAACTGAAGACCAAAGCATTGCAGTTGAACTGCTGGGATAGAAGTGAG
CTGGAAGGGCTTTCAATCACAAGATAGTGTGAGTTGCTTTTATCATTGTAATGCTACTAATTTTGTTGAGCTCAATTCACTGGCACACGCAACGCAGTAATGTTGTTTGTTTCACATGAT
TGAAGGAGATGGGTAGGATTCCACTAGACATGGTTGGGGTGGGGGTGTATGCCATTTTCCCAGATTGAATCACACTTCTAGAGTTCCAGTTTATATCTGTTGTCCCAGCTGTTACCAAGG
TGAGAATTGCTTACAGATATCAGATAAGTCAGTTATGTGCCAAATCTTAAATGTTTGTGGTAACGTACCCAATATAGAACACCTCCAGTTTTCCCATATAGTTGTAACGGCCAATGAACC
CTCATCAGTTCACCAGTAGCTCTGAATTCTGAAGCATGAATATTTCAGCAGATCTGCAATGATCTTGCCTGTATGTAGTTTGCTTACTTGTTCTACCTGTTCAGCCAATGACAGCAATCA
TGTGGATCCGAAGATGTGCGATGCAGATTCCTACAGCCAGTAACAAAGAACTGAGCAATCCACTTCCGTATCAGCGATGTGTTGTTTGTTAACCAAACGTGGTCCTGGCAACCATTTGTT
TCTGCATGTGGCTGCACATTGATCACCAACCCCAGGTAGTCCGCGCCGGAGATAGCTGATGTGATCGCTTCTAGCTGTGGGGCCAGCTCGTACCGCCCTGTAAATGCAGAAATTTTGATG
TGACGTTTATTTGGGACATTCGGTCTCATTGGTTGCCCTTCGTCTTTGTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTAGAAGTTTGGGTGCCTTATTGGCCCTTTCGTGCATCATAATTCCGTTGCATGCATCATGAATCCTGGGCAAGCTGC
CCCCTGAATTAATGCTAGAATTCACCCCATGTAGCCGGTTGGTGCCGATCGAGTCCTTAGGCTTCGAAATAGTGTAATGGAAAAAGAAGTTGCTGCTGAAAGATTGGACACGGAAGTAAC
CGGCCAAAGAACCAAACGTGTTCTCGGATCCGAATTTCCAACTTGTGAGGGGAGCAGACGAGACCTTGCGGTGGGATCAAGACAGGTGGTGTGTCGTCGCGCCGCCCCGAGTCTCGAATG
CACGGCGGGCGGGCACCGGCGTCGGATGCGGGCCGCTCGTCCTAGGCGGCGTACTCGTTACGACGTTGTTGGTGAGTGGTAGTGGTTACTGCCATTTCTGTGGGCGAGTACTCGTAGAAT
GGCTGTCTTAGCGCCAGCTAACTGCAGCCCAGCCAAGCAAGACCAAGAGTCCGAGTGTTGGCACGTCATCTTCCAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGANNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNGAGGAGAAACGAGAGAGGAGAGCTAGGGGATCCTCCTCGTATTCTTACTGACGGCTGGTACGGCGGAATTGGGCTGGAAATTTGGCCGATGGTGGATAGCAGACGG
CAGCTGGCTGGGGGCTCCATGCAGCAGCGATGCTCTGACGACGAGCGGCGGCGAGGGTGCAGCTCGTCACGGCAAAGCTCCTCCTGGTGTCCGTTTGGTCCTTCGGACGGTGGTCGCGGC
GAATCGAGTGCGAAGGTTGGCGGCGGCGCTTGGCTCTGTTTGCTCAAATGGCGGCGGTGCGACGTGAGGGAGGACGAGGCACGGCACAAGAGCGAGCGAAGGTAGCAGCGAGCAGGGCAC
GGGCGCTCGGTCTTGCCTTAAATAGGCGCAGGGCGCGAGGCCGGCCGTGGCACGCACGTTAAGAAGGTGGCGGCGGGCTCGGAGCGGGTCAGGCCCAAGTCTTGCCTAGACGAAAAGGAT
TAGATTTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTAGAGAAATTCTAATTAATTTTTATTAAATCACAAATGATGAAAATTAGGATGT
TACAAATTCTGCTGCTTGCGAGTTGCGACAAAGCGAAAGAGGCAAAACATAGTAGGCTTTGACTCGTCCTGTCCTGGCACACATCGCAACGCAACGAGCGTCCGCCGAACGCGCTCAAAA
GCGTCAGGACAAGTCACCCACCCAACAACAACCCACCACGTCCGCGCACCCACGCGGAGGCGTCTCGTGCTCTCGACGGCAGCCGCGGGCCGCGGCCAGAGAGAGGTGGGCGGGCGGGGG
TGGAAACTATCTGTCAACTAACTGCTGACCGGTCTTATTCCTCGCACGTCTTGGTATGGGCAAGTGCGATAACGACCGAAGATAGAATCAGAGATCAATAGTACTACTAGCATAGCAATA
GCATGTCCTTCCATCGCCTTGGTGTGTCCGCCTACGACGGGCGCACGGGCTGCTGCTGCGTGATGCAGTGGACGTTCCCGCCTCCCAGCGCGATCTCCCGCCCGCCCTCGACCATCACCA
CCTGCGAGCCAACAAAGATCACGGGCCTCATCAAATCCAAGCGAACTCCAGTGCTCTGCCCACACGCGACACGGAAACGACTCACGTTTGGAGCTGGAATGCACGTTGAAGTGAAGATCT
TAATTACCTCGCGATCAGGAAACGCCTTCTGAAGAACCTTGTACGCCTCCTCGTCCCACTTGTCGCCGAAAGACGGCGCTACGATGCCGCCATTCGCGATGTAGAAGTTCACGTACGAGG
CGGCCAGCCTCGTGCCCGGCTCCCTCGCCACGGCGTGCCCCTGAAACCCCAACCCCCGTCCAGAGATTCTCCACTTTTAGCGACGGCTGAGATCAGCACTGCAAGCAAGTAGCTTCTAGC
CTTCTAGTAATGTTTAGCTGTGAACGATACTGACTGTTGAGAGAACGCCGTCCGCCTCTTCCTTCGTCATGTACAGGGGCCCCGGGACGTGGATCTTCACCACTTCTATCTGCCGTCCTT
TAGCGTCAACCGATTGGGTCAGAACCGACAGCGCCTCGGCTGACCGTTCGTACTGGGGGTCCTTCTCGTCATCCGTCCACGACAGGAGGATGACGCCGGGTTTAATGAAACAGCACAGGT
TGTCGACGTGGCCATTTGTGTCCTCGTCACCTGGGCGAACGGTCAGAAGCTTATTTGCCAGTAAGGCAAAGTAAACGTCTAGATGTGAGAAACAAAAATTATTTACAGTCAAAATACTTT
TCTTGTTTACCGTAAAGTCCACGAGGTATCCAGATGACCTTTGTGACTCCCAGAAAATCCTTCAGCTCGTTCTCTATCTCTAGTTTAGTCATGTTGGGGTTTCTGTTTGGATCCAGCAAG
CATTCTTCGGTTGTTATGCATGTACCTGATGAAATGTGACCATTAGATAGGAAGACAACCACAGATAGACACAAACTATCTTTTCATCGACAAAGATCTGAAACATCACATACCTTCTCC
ATCGACATGAATGCTTCCACCCTCGAGAACCATTTTGTGCGAAAACCTAGGGATCCTCTCAATCTCAACTATCTGAAATTCATGGCCGAAAGAGTAAAGTGAGTTACCAGTACGGAAAAT
AGCCTAGCACAAACATCAATTTGTTCTTTAGCGGGGCTCAGTTGCTTACTTTCTTGGCAATATCATTGTCAAGACTCCAATCGTCATAGATTCCTGCAGGACAGAAGTAGGAAAAAAACT
CATTTTATGAAAAGAAGGTAACTCACGTTGGGCTCATCGGCTTGTGAAGTTAAAGAAATTCATATTCTAAAAACAGGAGTGCTTCTATCCATGCTTTCCTAGAGCAAATTAATCAGAGAT
TCAGATCCACAGCTTACAACTACCTTTGGAAATCACTTGCTGGTTGCTACTAAGAATAGTTATTTTGTTAAGTACTGATTAACAATTGGCACCTTTGCATGAACAGGAAGCTAATTTGTG
GAAAAAACTTGCATAGAACTATCATCAGGCAAAACAATAATCGAAATAAGCAGTATGAAAAAAGTGCAGAGCAATCATGTATAGTTCAATTTAGTAAAAACATACCTCCCCAGGCGTTAA
ATTGCCAATCTATCCCTGCTATTGTTTGTTTTGTGATTCCTGACTCGACTTTATGAGTGATAAACTGAAAACCAGGAACACTATAAGCAAACGAAATCATCGGACTGGAAATGACAATAG
AAGAAGGCAAAGATTTAAGTGACGCACAGTGGGTCCCATATCACGGAACCAGGAATCGTTCATGTTTATTTCAATCACCCTGATGTTCGTATGATGTTCCATCAGCTTGTGGACATACGG
GTACTGCCAGAGACAAAAATTTGAAACTGAATAACACATGTATGATAATAAAGCGTTCTGCATTTCTACCATACAGTTGAAAGGTGGCAGATGTGAGACAATCTGATACCTGCTTGGTAC
TTGCACATATTGTGACAGGCTCAAATTTTGAAATGGCAATTGCAGCTCTCGCAAATGTCTGTTGAGCTGGACCAGCATTGTCCCGCCAGTTGTCTGGACGCTCCTGGCGTTCCAAAAAAA
AAATGAAAATGTTTATCATGATAATGCACTTGGAAATGTTTAAAAAAGTGTCATGTGCACACTCACATGCATGGACAAAATTGAGCAGAAATTATTAGGACCACCTTATAACTTTCATGA
TTCTCTTTGCTAAAATGAGCATTATATTCAGTTTTGTATATATTGGCAGGTTGCAGGTTGCAGGATCAGCTTATTTATGTGTTTGTCATTGAAAGTCATCGGCAGATTATGATAATGGTA
GATTGCAACATCAGAGTTGCTATGCCTACTTCCAAACAAAAAGAGAAACCAATCACGTCCTTAGAAATTTAGAATCTAGGATACTAAACTTTGGATACTCTGTTTGATTCATTAGTCCTA
GACTTCTAGTTAAATACAACATATATCGCTGTCAAAGCTAAAGATTCCAGCAACAAAATATTCAAGATTCCAACTCCACACGGCAATACTAGTAATTGACCAGTTGATCCGGCGGCCGAG
GCGCTAACTGCTCCCAGCAACATGCAAGTTGGAACACACCCGTCGGTTTTACAACAGAAAGACTGACCGATTCGTTTCGCAGTTCAAGAAAGAGAAGCCTACAAGACTAGCCGCGTTAGG
ACCATATAATTCACAGAGCACTGTGGCCGCACATGATCGATCCAGTTGATCTGGACAGAACCACTGATGTATGGCAACTAGCAAGTTAAAGAGGTTGTTTTCTGCTAGACAAGTCATGGT
GGCGCAGCTAGCATGATGGAAAGCATAATCTTAACTTTCGTTTTTTTTCCCTAAAAAGCAGCGTCTTATTGCTCAGTAAAAGGCGAGAAAGATCGCGCGCGCTGACGCGCAGCGCTCAAC
CTTTACAGTTTACTATTTCACGAAAAGAACTTGATGACTCCTGAACGGCAATCCCGCGGGCGCAAGCAATCGTTTCTCAACCAAACAAAAGCACTTTCTAGATGAGAATCTGATTCCAGC
GCGCCTCACACGGATGGCCGGAAACCACGGAGCACCGAAACGAAGACACGAAGAACGAAGAACAAGCACTGAAGAAGAAAGGCAGATCGGAGAGGACGAGGCAGGGGAGGGAGGGAGGGA
AGGAGGAGTACGTACAGGCCATCCCATCCAACACTGCTCGTGCGGTTCCCACTCCGCCGGCATCCGGAACCCCATCTTCGCCGGGCGCCCCTCCATGACCTTCGCCATCATCGTCCCTGC
CGCTCTGTCTCTGTCCCTCCCTCTCCTCTCTAAATTAACCCTCGAATCGATTTCTAACCACGGGTCCAGTCCAGGAGGGCGCGGGGGGCCGCTTTATATAGCGCGGCCTGAGAGGGGGGG
GGGGGGGACGAACGGCAGCAGGACTGCAGGAGGAGGAGAGCGGGTCGCCGAGCACGTGANNNNNNNNNNNNNNNNNNNNNTTTCCGCTGCGCCCCAGACTCACTGGCCGGTGGGGCTGCC
GCTGCGAGAGCGGTTGGCCAGTCAGGCCGTGGGCGCCCATCCCGACGACGGTGCGGGAAATCCGACGTGAGGATCGATAGGGACGGTGAATCTCGCTGGCCCGTGGGACCCATGCTGTGG
AGATGCGGCGGGGGAGAGGAGGACGGCGGATCCCAAGTAATCCAACCCAGGCAGGGCAGGCCTGGACCGGGCACCTCCCCCGCGCGCGCGCCACGCGGCCACTGGAAGACGACGACAGAA
TCACACAACCCCACAAGTCGGAGACGGGCGTGGCCGCAGTGGCCGCCGCCGTGTTGCCACCAGGTTCCGCTGGAGGACAGGGTTTACGGCTGCAGGTTTCGCGTCGTGAATCACGCACAA
TGTGACTTTTTTTTTGTCTCTTATTACAAAATGTTTCTAGCTAGGTGCCGAACTGTATTAATTCTTCGACAGGATTAACAGAGAAATCCGACTGAGAAAATTTATTATCCGGTTGCAAAC
ACCATGCATGGAGCTTTTCTGGTTGGGGATGGGTAGTCGTGGGTTGGCCCAAGCACACACATTTCATTTCCACATGCCATGCCTCACCTGGGCTGAGGCTAAATTGATCCGACACCTGAT
GAGTAGCCCAACAAAAAGAAAGAAAGCCCACGGACCCAATTTTTCTCGACAAAAATCTCCTCGGCCATATCCCCCGTCCGTGTGCGTCGTCGCTCGGCAGGCAAAGCAATCAGACATCAG
GCACCACCCGACTACCCACCCGAGCAAGATTGCGGAAGCCAATCGAGAATCACCGCACGATTCCTCCGCTCGGCTCGTCTCGTCTCCTTCGGGGAGTAATTCCGTCGAACGCCTCGCGCG
CACGCCCGCCCTCCCGCACCGCCCGCGGCCTTGTCCCGATCGAATGCCGTAGGACGAAGCGGAAGAGCGCGCGCGGCGGTGGCTGCCATGCCATCCATGGCTTCCCTCTGCCCCTTATCC
GCCGCGCCCTCCTTCCCGCGCGCTCACGCCGCCCGCTTCAGGAGCCCCGCTTCCTGCAGCGGCCACGCCGCGACCGCAAGGAGCAATGCCTATGTCTGCGGCTGCGGAGCTCCACCCGCC
GCGGCCAAGGGTTGCGCGGGGCTGCGGTCGCGGTGGAGGAACCCCGTGCGCGCCAAGGTCGACGAGGCGGACAAGGACGCGGGCGCCGGGCTGGGGCTCCCCACGCCNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNTCGTCCTCGCGCTCCTCCTCTTCGCCGCGCGGCTCGCGCTGCCCAAGAACGTCGCCAAGGAGGTGGCCTACTCGGACCTCGTCGCGGGGCTCCGCGAGGGC
GCCGTGGCCGCCGCCGCGTTCGAGGAGGACTCGCGCCGCATATACTTCAGCAAGAGGGCCGAGGACGGCGACGACGGCGACGAAGCGAGCGAGGCCGGTGAGACCGAGAGCGCCCCGGAG
GCGGCGCCGAAGTGGCCGTACTACGCGCGGAGGGTGCCGCACGACGAGGGGTTCCTGCTCGGGCTTATGCGGGAGGGCGGGGTGGACTACCGGTCGGCGCCGCGGCCTGCGGGGAGACTG
GTGGTGGACATGCTGAGCACGCTGCTCACGCTCTGGGTCTCGCTGCTGCCGATGATGTGGTTCCTACAGCGGCAGCTGTCTGGTGGGGGCAGTGCTGACAAGCGACGCAAGCCGAGGAAG
CAGAGGGTGGGGTTTGACGACGTTCAGGGTGTAGATGAAGCGAAGGAGGAGCTTGTTGAGGTAAACGTGGCTTTTGCACTCCTTACTCATGAATGTTCTCTGTGATGCTTGATGAATATG
GGAAGACAAAAATCATTAGGCAAGACACATTTCATCTTGAAAAAAGGCAATATACATAGGATTCGAGAGGAATGGAGATGGTACATCCACATCGATACAGAAATTAGGAAATGTCAATCA
AGCATACTGTATTTGTGGTGGGCTTGCTTTTGCTTTGTCTTAGAAAATCACTATGCATATAGTGAATTGCAATCACCTCTTAGTCATGTGCATACATTACATCAGAGCTATGCTCCATTT
ATCAAGTGGAAATGTCATTTTGATAATTCCTCTGCTTTGCTCTTGCATTATGCATTAATCAGATAATGTATGCCTACAAACTTCGGCAATAGTTTATTTCACATTTGTTAGACTCCTATA
AGAGCTTACTCCGTAGGTCGTTCGTGACACGAACTTGAAGGCTTCATTCATCAGTTGGCTCAGTGTTCACTTTAAAGTATTTTTTCGCATATTAGAAGAAGCAAAACTTGGGAATATGAA
CATTACAATAAGATCTTTTGAGTTTCATTGAGGGGAATTAAGCCTGTTTGCCTTGTATTTGCTTACTTTTACGATGTGCCTCTTGTACTAAACCATGCCTTTGCACCATTTTGTTTACGA
AGTTCATTGACGAAAATAAAAAATGCTGAGAACACTCTTACAAGGAACAGAAATGTGATAGCTCCTGGAAGTCTGGGACAACAGGGCAGATATAAACTGTTGAATGGTTACTTTGCACTT
GGGCTTTGTACTTGCATCTTGCAATTATATTGGTCTCAAATAATGTCCTTTAGTAAGTATTGAGTGCTGTTTTTTTTCCATAACTAGGAATTTCATTGGTCTGAAGTTGTTTCTTTTTCC
CTTGCAAGAATTAGTTTTGCATTACTACTGAATCTGGACAATGGTCATTAAGAACCTTAGTAAAACATGGCGATTTTCCAATGCAGATAGTAAGCTGTTTGCATGGTTCACTGAACTACA
AGAAGCTTGGAGCAAAATTGCCCAGGGGTGTCCTGCTTGTTGGCCCTCCAGGAACTGGAAAGACTCTGCTAGCAAGGGCTGTTGCAGGAGAGGCTGGAATTCCATTTTTCTCTGTTTCTG
CTAGTGAGTTTGTTGAAGTTTTTGTTGGAAGAGGTGCTGCCCGGGTCAGGGATTTGTTCAAGGAAGCCAAAGAAGCTGCTCCATCAATCATTTTTATTGATGAACTTGATGCCGTGGGTG
GAAGTAGAGGTAGAAGTTTTAACGATGAGAGGGACCAAACTCTAAATCAGGTATGGTTTCTGGCACTCTGATGGTCTTTCATATCCTTTGTCTAATGACATCACCAAAATATGTTTCCTT
GATTTTCTCTATCAACAGCTGCTTACTGAAATGGATGGTTTTGACTCGGACATGAAAGTTATTGTCATGGCTGCTACTAACAGGCCAAAAGCACTGGATGCTGCTCTTTGTCGGCCTGGT
CGCTTCTCCAGAAAGGTTGTTGTTGGTGTGCCTGATGTGGAGGGCCGCAAAAAGATTTTGGCTGTTCATCTAAGGGACATTCCTTTGGAAGAGGATCCTGAAATAATTTGTGATCTGGTT
GCTAATTTAACCCCAGGACTGGTTGGAGCGGATCTAGCAAACATTGTTAATGAGGCTGCTCTCCTAGCTGCACGAAGAGGTAAGTTAAAATCACTTATGTAATAAAGGTAAATCACACAT
TTGTTGCTTATGCATCAAATATGATGTTGATGTCAGGGAAATTATTTCTAAATTCAATGGTGCTTTGAGTTGCATGGTTTAAAACTTACTATTTTTGGTCCATGATTGAAACCTATTATT
GAGCTATATTTCCTACTAATGCTATTGGAAATTATTACTGGACTAGTCATAATTCCACTTGCTGTTCCATATTCTACCTTTGCACTTTGAAATGAGATTAGATTCTAGGTGTTGGTTTAT
TAATCCCAAATGAAAAAGGCAATTGGAGAAAATATGTTGATATGGAACTTATTGGTGCTGATCTGTCCAGGTGGTAATACTGTTTCCCGGGAGGATATTATGGATGCAATCGAGAGGGAG
AAATATGGGGTCAACGGCAGACAAGAAACCAATGACTCTGAAAGGCAAGGCCTCACCAAATTATTTCCATGGCTACCTAAGCCTGGAAATAAACCATCAAGCCCTGATGATTTCCGAGGA
CTGATGGGTTATCAGACATTAAGCTAACTTAGCAGCCTTTCAAGGTATGTTCAGATTTGAGCCCTTTCCGAGGATATGATTCTTTTTCCCCCCCCCCCCCCCCCCCACCCTCTCAAAACA
ACATGTCTCGTATTCTTGACGTTCATCAAAACATTCCTTTAAACTCATTTAATTTGGTTTCCTTGATTAGTTGGATCAACTTGACTCACTCTTTGTAAGGACTTGAAATATGTCTGTGAT
GTTCCTTACTTGAGACATAGTCCTCAACAGCATTGCTTTGAAAAAACTACATTTGAGGAATCGGTGTAAAATGTACTCATATTTTGCTTGACAAAATGGACATAGGATAGTTTGGACTTT
TACTTGCCTTTCCTGGGAAGACTACACTATTTGTTCAAATTTTCCTCAATGGATCTTTTTTATTGGACCAACATAAGTTTGTATAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAGCATGAAAGCCTAAGCACTTGTAAGATCAAGAGCTCAAGATCTATCATGCACCTTTGGAAGGAAAAATGTAGCAGGCAGA
ACTCCGGAATGTCAAGTAATGAGAATGGATGTTTCCAGGTCTAACCATACCCTAGCAGCATTGGGTCCACACTGCATAGGTTTGGGACTACCTAGATGACAGGGTACTGAAAAAGTGCAG
TGTATCGCTACCGCTCACATTTCTCCAACAAGTATAGAGGAGGGCATTGATTGTTAGAACGTATCGATGGCAAATTATTCATTTTTTTCATGTCCTGATTATTGTTATGGTTGCTTAAAA
TGAATCATAAAGTATGTCATTCATATCACTGTTGTTATTTTGTGAGGCATTCCGTCCCTCCCTTTTCCCCTCACAAGATATTTCATTTTTAATTATGTAAGTTTTTGGGCAATCACAACA
TTTGGAATTGGTTGCATGCCTTTTTGAACATGCTTCCTTTGCTATCTGTGATTTTGGTACGCAGTACAGCTGTAGAAGTCATGACCTTTTGTCTGCTGAACTCTTATTTGGCGTTTTGCT
TCTGTTGTGCAGAATCTGGGAAATTGTTGCCTGTAGTTGTATTGTATAGCAGAAAATATACATCTCCACGGACCACAGTATGTGTGAAGGATGTTGAAATCGGTGGCTTTTGAGCTCTGG
CACTTTGTGAAGAAAGCTGTTACAAAATTACACGAGGATAGCTTGTGAAATGCGGAATACCAAGATTTTTCCTAGCTTAAATCAGTCTTGCGCTCCATAATTTTGGTAGAAACATTGCTC
AGGTTTTGTCACAGCCTGCACTATTACTAATAGAATAGTCTAAAATAGCTTGCAAGCTACTGGTGCTCCTGCTGCTGTACACAAGTCAGCCACCTGTCTGATTCTTACAAANNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNAAACTCGATGTCGAGAAGTTCTGCTCAAGTTGGATCTGCAACGATGTTTCACTGCACAAGTGTGCTAATAGAGTTAGATCTGCAACCATGTGCGA
GTGTACAAGTGAGAATTGAAGCTTCAACAATTTGCAAGCGTACAAGTGAGAATTGGATCTGCAATGATGTTTAGGAAGCACATTGTGTCATGTTCACTGTTCACATTTAGCAAAAAAAAT
TTCATGTCAACTTGCATTACTGCTATTCTGTAAATCCACTGAATCACCATCACAGTAAAGAACAGACTAAGTAGCTCTGGTAGTTTCAAATGCAAAATCGCTCAATCTGTCAGCATTTAT
GTATCAAGGTGGTAATCTTTGCTGTGCTCATCTAGTCATATATATGTGCCATTTTCTCTAGCATCTGCTTGATCATTAGCCTTCCGGGATGATATTTTGGCCACAGGTTCCCAAGTGCAT
GACTAAATGGATTCCTTGACAGTTAGTCGGAGATCGACGGGACCTAATTGACCTCGAAAAGCCTTGTGCTGTCAGACGCATATCCTGCGGCGATGCCGACTTGACCTTAATAATTGGGAA
GACATGCAGGGGCTGCAGAATCAGGACATGTACCTTTGGCAAAGACGAAGCTTCTCCTGCTCTTCCTCAGCAAGGAAAAGGGAGTAAAAGGTGGCAGAGCTTTGGCGTTGCAGATTCTGA
ATGTCATGAACAGGAATGAACTGTATGGCTTGGCTTGGCTTTGTATGTCGCTTTTTCTGGGCTCTATGTGCTGCTGCTGAGGCCTTGTTCCGCAGGATCAAATCGCAGGCTCAAAAGAAG
GGGGAAACATGGAAACTGATTTGTAGCTTTCACTCTTTTGCTCCCAGTGCATATCTATCTATGACTCTAGGCGAAGTTTACTTATCCTTCAAGATAGAATCCAATGTGCTGCAATTTGGT
ATGACGCTATTCTGCAATAGTTTTCAGAGAGATGCAGGTACCTCATGACCACCAAGCCGGTTTGAAGCAGTTGCCTGCAAATTGCAAACTGCTGCAAAGAGTCATGGTGACAATGGGTGA
ACTATACAAATGTTGTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAGCCACCACCTGTCTGTGAACAAGAGTTGGGA
ATGGTTGGAGGAATCTTGCTTAGAGGCTGGTATCAAAATACGTGTACAGATGACAGCTACTGGTCATACATATAGGGAGCACCAATTGAGGACAGATGTGTAAAGGTGATGAATGACATG
TCCATTTTGCATGCAGCCCTAGTTGTATTCTGCTACGGAATTGGGAATGTAGAGGATGCTACGATGATGTGGCATGAAATGATGCTGGCACCAGAGATAAGCAGACCTGCATTTTTGCAG
TTCTCGTGGAATCAGAAAAATCCAAGGGGCAGCTGATGAAAACTAGCTAGAGATGACCATACAACATACTCGCTAGGCACAGGCTTTGGGTGTTGTTGGCAAATGATATTTGGGAGTCCA
CAGATACCAATAGACTAAGACACGCGTGTGTAACGACTTATGTTTTTATTAATTTCACAATATACATAAAGATAAAAATTTAATATATATCCCGATAAGTTATATATGCGGACAAATAAT
TTTTAATTTTGGATGTATTTTTCCGATCCCCAGAGCCAAGTGTATTAAAATGCTAAAATGTACTCTATAACGGCGGCGGCGGCAGAGATGAGATCGAGGAGAAGGAATAAGAGGATTAAG
GAAGAAGACAAGTGAGATGACGGAGAATATTGTATGAGACAAGAAGCGAAAGCAAGAACAAAGTGGTTCACTGATGAGTGACTTTCAGTCGCTAAAGACCTAGAGCTCTGAGCCGAATAC
TTTCTATGCCGTAGGCTTCTGGTTGGGTTGCTTTCCCGACAAAAAGTTCATTCCCATTTCAGACGCCTTTTCATTCACCATCGATGAGGACCGGCAGGCAACGAACTGCCAATTGGTAAA
CTCATGGTCTTAAAAAAAATTGGTAACTAAGCTCATGCATGCACTAACAAATCACATGCGTTTATTTAGCATATATGTTTTTTCTTTATTTTATTTTTTCCCACACTATCATCTCATTGT
AATTAACCCATGGCTTATCTTTTAATTTTGCGAGGTTAGAATTTTTAAAACTGTAGCGCATACCCCCTCTAATCACAAATAACTGTCATTTTGGATTACCTACAGGCAACATGTTAAACT
TTAAGCATCAATATATCTTTACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTATGGCTCGATTTTTCTTCAAAGTAGCTTTAAAGTATTATAATTTTCTATATTTCACATATCAG
TATACACGTAATTTAGTTCTTGTTGCATGCCACTTACATTATTTTCCTTTTCCCACACTGTCCTCTCATTCTAATTATAGCTCATGACTTATCTTTTATTTTTGTGAGGTTAGATTTTTT
AAAACTATAGCATATACCGCTCCAGTCACAAACAACTGTCATTTTGGATTAACCTACAGTCAACATGTTTAAACTTTTAACGCCAGTATATATCTCTTTTAAACAATTTAAATAAACTTT
AATTTTGATAATTAGTATGGCTCGACTTTTCTTCAAAGNNNNNNNNNNNNNNNNNNNNNNNNNNNGTTTCACATTTCAGTACACACACACACGTAATTTAGTTCTTGTTGCATGCTCCTA
ACTATAATCCTTTAACTCTTTTAGGTATACCTACACGTGAATTTGATGTCCCGTTTTGTGTGCACGACAAGAAAATTCAATTTATATATTTGCCAATAATGCATATGAATCCACAATCCA
CACCTCTTCCCTCAACAGCACATGTATGGTCCCAGAATTCTTGGGTCGGTATCCTTCATATATGCTCGCACTTCGTGTACCGAGAACAACCAGGAGTATATTAACAGATTGATAGTGTTA
TGCCTAATTGAATACACACATTATCTGAAGAAATGATAGGCGGCAAAGCAAGAGCTAATTAGTAAGATAATTTTTGCACAGCCAGTGATTTAATGTTTTTAATTTAGTACCATTCATTTA
TGCAAAAACAAGAAAAACCTCTGGATGCATATTCTTACATTAGGTTGTTACGAAGAAAATAGAAAACGACCTTTCGTCCTATGCCTTTGTACCGGCTACTTTTTGACCCGGTGCTATTAG
TACCGGTCCAAATTTAGGGGTCTCCGGAGGACCTTTAGCACCGGATCCCTTTTAGTACTGTGTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATGCGTATAGGANN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTTGGGGTTTGAGTACCGGTAGTAAATGTCACTTCTCGACAGCTTCTAGAAAT
TCAAAAATAAAATGAGACATGTATGTAAGATGTTGTTGAGAGCATTGTCTTCGTAAGCAAGTACAATGCTAGCTAGTTCTGGTTTTGTTCAAAAATTGCCATAATTTTTCTGGATGTAGC
TGCTAGTTTGTGTTTCATCAGTCAACAATAGATCACTTATTTGGCATGCAATCATCTCTTAGGTGGTCAAACATATACGGATTATTACTGATACGTGAAACCACTCTTGGTAGGACGGCA
CATCAGAGGTCGATGATATACACAACACTCTTGCTAGAGTTCAAATATTGGTGCATACATTTTACATATATGAGATTGCTTTCAGCAGTTTTTAGTTTGGAGGAAAGGTGATGGCCAATG
GGGATCGAAGTGCACCTATGATATGTGTGTTGTGTTCGTCTATGTAGTCACGAGCTATCTTTTACAACCGAACAAAAGTGTTTTTTTTACTCCCTTTATTCTTAAATATATGAAATTGAA
CCCATTGAGTTAAGAATAGTGGGANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTAGTGGGAGCAAGTACATGGTCTACTGAAGAAATTTTTTTTAACGTTTGCAATTATAGAACACAAAATATATTG
ATTATTTCTAGAGTACACCTCAAATAACTCCATATATTACTAGACTAGAGTACAACACCGATTTATTCACTTTTATGATCCTATGCATGCACGCCCCTGATCTCTTACACACACATACAC
ATATGGCTACATTATTCAGTCGACCACCACCGAGCATATATAATTAAGCACGTGAGCAATATACATAACACTATATTTAATTTAGATATATGCTTAATTTGCTCGGCCCTTGATCTTGCT
ATATATAAATCTTGCATTGGTGCAGATAGACCTCAGCTCGACGTCGTCGGATTATATTGAAGCAGGCGGCATGCATGCATATACGCCCGGGCCGCAGCATCTATCAGCTTAGCAGCTAGA
CGACGAGGCGCCTCCGGTGGAAGGTGGCGATGAAGTCGGAGGCCTTCTGGTCGACGTCGCGCTCGCCGACCCACCAGCCGTCGTCGTCGTCGCTGGACCGCACCTTGCGCAGCCTCGCCG
GCGGTCCCTCCCAGTCGCTCGCCGCCTCGTCGTCGTCGTCGACGCCGCGGTAGCGCCTCGACTTGCGTGAGAAGCTGAAGATGCAGAAGAACGACCTCCCTCCCATATACTTACCTGATC
GGTCTCTTGCAGTCACTCACCACCGTACCCTTCTTGCAATGCTACACTTTTTATTAGAAGCTGAGAAAGAGATGGAGATATTAGCTGCAGCTGCTGCCTAGTGGTTGGGGCGTTGCTGTC
TTGTGGGCAAGTGAGAAGAGACCACACCCCAATTTATAGTGGAGGGGGGCTTGTGCATGGAAGCTGCGAATTAGGGGTACATAATAATCAAAGATGCCCGATCGGGGAGGATCGAAGCAC
GGACGGCCTGGATCGTATTGTCAGATAAAGGTTGAGATCCAACGGTTGCGATTGCCTGACATGATAAGATGCTAAAGCGGGGCTCTGGATGTTCTGTAGCGCACGATGTGGTTGATGAAG
CCATCTTTTAGACGAGGAGAAAAAAAGCAAGCGGCAAAGCGCTGCGGTTTCGTTTCCAAGCCTCGATCAGCTTTGCATATTGGGGGGCGGATTTGAGAGAGCGTGATGGTCATTGCAAGT
TACCTCGTCATTTGCCTCACTGCTACGTTCTGATGCATGAGACAACTTTTTCTCTTCAAGAACCTGAGATGAACTTGTTTCGTAAGCTGTTTAATTTAGAGAGCTTTTTGTAGCCAAAGA
ATGACGCTATTGTGAGCAACTTGAGCGTGCATCGATGCACTGAGTTGCTTTGTGCCCAGGACGATTGTGTCGCCGCATTTCCGAAGTTGTAAGCCACTANNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGGATACTCGTGGGATGGAAGAAAGAAATAT
GCTGTATGGCCCCAATTCTCCTGGTATAACGGTGCTCAACAAGGGGTGAGTTGTTTCCTGTGCGCACTGATAAAAGGGGGCACCTCTTTGTTGTTGGGGCATCCTCTGGCCCTTAATGTT
CGTGCCTTCGTGGTGCCTAGTGCCTACACTAAGATAATAGCTATAAGGAAAAAAATAAATAAATTCAGATGACCGAGGGCTATTGTTTCTTCTTATTTTTTTTTCAAGTGGCCAAGTGCT
TTGTAGTCTATTCTGGATAATCCCATAGGTTAAAAACAAATTAGTAACAAAGAACTCACGACCAACATTTTATTAAAAAAAAACATCTTCCACTTACTAAATAACCCTTGGGAAATGGTT
TAATTTAATTGAACTAAAAACCCTTGGCTATTTGAAAAAAAATCAAAATAAATGCGGAAAAAACACTGAAGAAATGTTAAATATCTAGTAGTGGGAGTTAATTAAGTCTCTCATTATGCA
TAAGTCTCTCATTGCATAATTATTGTAACTGAGGCTGTTGCATAAGTCTCGTTCTTCCTCTTTACCTCCGAAGATAGTACAAGGCACAGCTGTGNNNNNNNNNNNNNNNNNNNNNNNGTA
GCTTCTTTTTTAAGGTTTAGTGCAAGCTGTGATCCTCTATATGATTTGGCTGCCGCAAGGCAATCATATGGCGTCAATACAATACTTCCTGCACAATTCAGTTCTACATTTGCACAGCAT
GGCTAATTGCCAAGCCAGTACCCACATAGAGCTTAGCTCAGGGGATGTGGGACACTCATCATTAGCATCCCCGATGTTGTTTGCCCAGTACTAAACATTGCATGGCTGTCATCACATTAC
TCTGGAAAAAAGGCAAAAAGGATACTCACTCAATCATGAGGTATAACTGCCTCCCATTCTTTGTTCCAAAACCTTTGCGGCTGAAAGGAACCACACGTTATTTGGATTCGTACGTGTCGG
TCAACGTACGTACATACTCCGATCCGTATATAGGTACGTATATGTACACATCGTGCCAGGCCAGCAATATACAAAGAAATTTTGGTTTTGTTATTAGATGAAACTGATGCAAACTACATT
GATGTCGTCGAATCGAACCTGCATGCGACGATCGATCCTGCAGCTTGCCTAGTTAGCTGAAGCAACGGGGCAAAAAAAAAAACAAATTCATAGGTCAGGTCAATGTATTTTCTTGTTTGG
GCTCGCATTCTTTATATTCTGCCTCCAAAGTAGCTAACAAGCGACGACATGTGCAGGCGAGAGTTATTAAAAAAATAAAAAAGGGTAATGCTGTATTCCTTGTGTTCTCTTGGAGCTCAC
GAATGAAGTGACCAGGAAGATGAGCAAACAATAATGTGATCACCAAATCTTTTCTTCGTACAGAGAAAAAAGTTTGCTGTGTTCAATATTACTTCCAAGATCACTTTAAAAAAAAAAACT
CGACCAGAAGAAGAAACGTCCCCAGCACTGCCCAATATCTTACGGAGATCCTCATGCTCGGTCGCCTTTATCCCTATGAAGGGTACATCGCATGTGGCAGTAATGGCACATCCTTAGCCC
TAAGCAGTAAGCTCTAAAGTATATGATATGAGATGCAATCTCCCCTTCAAGGTGCCATACATCCGGCTGTACACGCGTTTGGCAGATGTGCTGTTGCATCACAAAAGGCACAGGCTGTTG
TATTGTCTCTGTCGAGCCCTACTGCACCTTAGACCCTGCAGCGTAACACCTGCCTCTCGCTTGATCTAAGGCTTGTAACGCAATCTGAATCTGAATCTGTCCAGTTGATAAGGGGTGACT
GTTGATCGATTGTTGCCTGACTGGCGGATCCAGACTTGATCAATTGTTGCCTGGAGGCTGTCTGCGATCCAGCTAAGTTGACAGGATTGTTGTCAGCATGACATGAGATGTGACATAGTG
TGACATCAGGGCTGAATGATAGTAGGATCAGTTAGATAACATGATAAAAAAAGTGGCAGAAAAGAAGTCATTTAGAAAGAGCTGCTCCTTAATTTTTCAGTTATTTACTAGATTTTTTCT
GCAAAGGACCCAAATCAAGGTTGTCTAATTTATATGCAAATAAATGAGTTGCATACTGAAAAAGGAAGTTGTTTGCGATGGTATTTTACTAAAGTACAGATTTTTAGATGGCGTTTATAA
TTTTTCATTCTCGTATATGGTTACTTGGTTATTGAAGGATTGATAAATTTATCCTACAAGTTGACTATCAACAACTACAATAGCAGTAAGCCGAGCAAATTTCAGTGCTGTCAGACTGAA
GAATTCTCTTCGTTTTCCCTAAAATGGTAACACTAATTTATGAAAAATCAGTCTGCAATCATCTTATTCTTCGAATCAGCATAGAGATCACGAGATAGACGACTAAACAGAAAAAAGCCT
TTGTGGTTGTCAACAGAGATACTGTATGCTAGACTCTCACTACAAGAAAATGATACAATCATTTTTAGGAAGATCCATAGCAGTCATTTGTGTGCTGAGAATAATGTGTTCTTTTAAGAT
TATAATTGACTGGCATAGCTAGGCGTATTATCGAAAATGGGTGTAGTATTATTTTGGAGGTCTTTTACGGTGCACAATACTAGCATATACTAGTGTTCGAAAAAGACTAGTATGAAAGGA
TCCGATAGTCTAGATTAATTGTATACTATTAAAACCCTCAAGTGTGGTCTGAGTAATACAGTGGAGTAGTATATATAGTATAAAGGTATTATGGGAAAGATCACAAGGGGTGTCATCGTA
ATATAGTTATGAGTTATGATATCACTTTTCGTTGCTCCATTTTCATTCTTGATTCTTCGTTTCTTTCTCATCTCATCTTATCTTCCTCTCGCGTACTAGCGGCGGCGGTGGCAGGGCAGA
CCTCGTGGCGGCGGCGACTTACTCGCACGAGCGGCAGCCAATAGGGGATGGGCTCGCGCGGGCCAACGTGAGCAGTGGCAACTAGCCGGCAGGGCGGATCCTACCGAGCACGGTGGAAGC
CGACAAGACGGCAACAAGAGGCGGTGCAAGGGTCGGAGCAGCCGAATGAGGGTGGGGCGCCGTTTGCCGGATCCGCCTCCGGCCTCTTCGACCGAGCGAGCGCCGCCGAGCCATAGCATC
GATGCGGCCCTAAAGATTATTCCGACAGCGGACAGCCTCGCAAACCACACGTTCAGCGTGACCCCGACGACACCATCGACACGTCGACGTTACAGATCAGATTTCCCTAAGGGTACCTTC
AGACGCTGCTGCGATATTGCGTTACAAATCCTTAGTAATTTTTCTTTTTTTAGAACGCTCTTAGTAATCTTCTATGCATGCAGTCCATATATCGTCTAATCGAGTCTTAGTTTTTTTTTC
TTTTTTGCTGCTGTGTTCACAAGGATGAGCCACTGAAACTATGTGCAAGTACTTTACGGCACTCCAGATCCAGATGTACATGTACATTTTACTCCAGAATATCTTTGATCCATATTATTT
ACATGCCTGACATGAGTTTACCCAAATATAGTCTGTTGTATATGAAACCTACGCTACTCCGACAAGCTAACCTTATTTCTAACTCAATCTTAACCACACTAACTCCTACCAAAATGATCG
CGTAGTCTGGTCCACGTACCACTTGCAGATGGGCAACTACAGGATCATCCAAAGCGATCAGGAGGAGCTGCTGCCGACGAACAGCCTCCTTGTCGAGCCTATCGAGTAAATCAAATGGAG
GTATCAGATTCAAAAAATTTGTCAACATTTAAATAATAACATGGTACAATTTGCCAAGTAACATAACCAGGAGCAAAATAGAGCATGGATCGAACTTAGTTTATTGTCTGAATACTAAAA
ACTAGCTAGAAAACATGAATCTTATATTCCTTTTCAACACAAATTCGCATATCCCATAAAATATTCCATCTCATGTATGTATGCCTCCAGCCTCTTGACAGCATCTCTCTTGCTCCCAAG
TTCTGATAGCATCTTTTGCTCCAATTGACCATCTAACCACAATAAAGATTTTTTTTGTAGTCAGTGAAAACATTCACACAATACTAATGAGACTGAATTAATTGCAGTCTATGCACACAA
AATCTTGTTTACATGAAAATATTAGCTGCTGCAGGCAGCAACAAACCCATGTCATTAACTTGGCGCTTGCCCTTTGAGAGCATGAACACATCATTTATGTCTTTCGGAACTGATGTGCCT
CATCACACTCAATATGCAGAAAAGTTTCTCATTTTATCCGTTAGGAATAACTTCCATGGTCCAAACAGCATAAAAAGCAATCAGGAAGAATAGGTAAGCACATACAAGAAGCATCATGAA
TTATTTCAAAATGACCTGGAAGCAGAGATACTGGAGGATCCAGCACATTGGGGTGGCACGTGAAGGAGGCGGCATCCTGGAAACATGATAAAATCGGCAGGGGCGAACGGGGAGGCAGCG
GCTGGCGGCCAGCGCAAAAAGACTAATCATTCCCCAATTAATATCTCAGTAATAATTACTAAATTACCCTTACTGATCAACGGTTAGATCTTTGTTATACTCTATACCACCGTGTGGTAG
TATTGTGCACCGTAAAATAGCTATCTTTTTTTTTACTCTGGACCCCACGAAAGTGATGCTCTGGCTCATTGCTTAGATCCTTTCTCAAGGCCATTTCAAGCCGGCTTTACTGTAGAAAAA
TAGTTTGCCTGAGAATCAGATGCATCCGAACAGGAATTTGCTGGAGGAAGAATCTAACTTAAGAAGCATTCAAAGGTATTATACTGTTGAAACAACACAGTATCAAATCTTAAAGGTATA
GGTACTGTTGAAATCGAAATGTGAAACGACATGGTATCAAATCTAAAGGCGTATAAATGCAGTTAAAGCAATATGGTATCGAGTTCCCCCATCAATAGTGTTTCACTTAGGAGCTTAGGT
TTAATGTCGCCATGCAATTTAGTCTCAATCTTGTTCAAACGAAGTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAAAAATTAAAAAAACGTGGGCCAGCAGTCT
CCACCCGCATCAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCTGCCGCTCCTCACCGAGCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNCACCTGGATGGAAGGTCAGCCTTGATTAAACAAGTTTATACATCTAAATAAGAAATTGAAAAGTACATCTAGCAAGTTCAAGTCAATTAAAACACTAACTTAGCATCCACATATCCA
ACAAATTAATCAACACAAGAACAGTCTTACCAGCAGTAAAAACAAACAGACTGTTGAAAAAGACAAAAGGTTGCCTGGAAAGAGCGGAGAGGATACATTAGCTTACAAAACACTTCCAGA
TGGTTAGATGCTTTGTTCCAGTGGTTATTTTTAAATAAAAAATAGTACGTTAGTTTTAACTCTTAACTTGGCTCATTTGAAGTCGTCAAAGTAGAGGAGTGTTCCAGTAATCTAGTTTAT
ATTTTAGATCATTCCACTATGCATAGAGTTGCAACATTTGTCTGCCGCTCCTTCACTTGACTCCAAATGCACTGACTAATAGAAAGAGTGAAAACTAGTGGACCTCCACTAACCCAACAA
CCCAACAATCCAAGTACACCTGTACATGTACAAATATACTTGACACTGTTGATGCTGGATTCCGGATTTCTGATCCAGACCCAAACAGGTTGCGGGATATAATATTTTTTCCTGCTTTTG
GCTTCTTCCATGCCTACGTCTCGGCCGGCAATTGCTAGTCCCCAACACTTCATTGGTAATAACGACTGGGTATAGATTGTGTTGACATTAACTTGCTTTGATCAGAACAGACACAAGGTA
AGTGAGAATCAATCTGGTGTTCTTCCCACACGCCCCATAACCTAAAGGATGCACAGAGGTTTGTGGCTTTACCTCTCTTCACCCATTCTGTTCTGCCTGATCTTTCAAACTTTGAGCTCA
TCAAATTTATCCGCAGGATATGAAGCACTGCTAGGATGCCTCTCTGCTGGGGTGATAGTTGGGCTCATTGCCGTTTTCTGCCATATCAGGAGAAGAGCAAGCAAGTTTAAACCATCAAAA
AAGGATATCGGTAATTTCATTAATCAGTTACAATCCATATACACATAGAAGTTACAGAGCTGGTGGCTTTTTACCTAGCAATATGTGACTGCATATGTTTATCTCACAGAGGTCACATTG
GTATCCCTTGAGTATGAGGAGACTACCTGCAAGCCGATGTCAATCAAAGATATATACACCGCAACTGAAAACTTAAGTCCATCAAACGTCATCGGCCAGGGTATTGCAGGTACATGTCCA
TAATAACCGGCTCAAGGTTTTGGTATTTATACCATCAAGCAAGCATAAAGTATATTTTTCATCAATGGGAATGAGACTTAGACCCAGGGAAAGTATTTAAAGATGCTGTTCTTGATGGTT
TGCAACTTGTTCCCCTTGTCGTTCCAGGAAAAGTGTACAGAGGAGTGCTTGCAAATGGCTGGCCTGTTGCAGTGAAACACATCGTTAAGAATGAGCATGCAGAAACCTTCCTAAGGGAAG
TTACAAGCTTGTCACATGTCAGGCACCCGAATCTGGTGTCATTAAGAGGTTACTGTGATGGGCGGGAGGAGTGCTTTCTTGTGTATGAGCTGTGCGTCAACGGTAATCTATCAGAATGGT
TATTTGGTGAGTACTAGGATGACACACATTTAGCATGATGGCTAGAACTCTAGGAGTATATACTTCATTTGCTTCAATGAAGAAAACAATAATTTAATTGCAGGAAAAGATAAGAACCTT
TCGTGGATTCAGAGGCTTCAGATAGCGCTCGGAAGCGCTTGCGGCCTTTGGTTCCTGCACATATATCCTGAAGGCTGCATTGTTCACCGAGACATCAAGGTTTGTTGCATGATCTGAAAT
GCTTCAGTGCATCTGTAGATTCACATTTAGTCAGACTCATACTTGCTAATTGCTATGACAGCCGACCAATATACTTCTTGGGGTTGATATGGAACCCAAGCTGTCAGATTTTGGACTCTC
AAAAGTCATCGACCTAGGTGTGTCACATGTAAGCTCTGAAGTCAGAGGAACCTTTGGCTATGTCGATCCAGAATACCGCCACAACCACAAGGTGAATGCTGCAGGGGATGTGTACAGCTT
TGGCATGGTGCTCCTGCAGCTCCTGTCAGGAAAACGAGCAATCAACATCATGAATACTGCTATGCCAATGTCACTAGACAAAATGGTAAGATCATAAGTTAAAGTAGGATGTTACATTAT
GGGATGATGAAGTAATTGATTGAGCTGAATCTGTGTATTGGTCGTTCCCAGGCTTCTACGCTTATCCAAGATGGCAATGTATTGGAGTTTGCTGATCCTAGGCTGAATGGAGAGTACTCA
ACAGATGCATTTGATCTCAGTTTGAAGCTTGCTCTGTCATGCACTGGCCACAAGAAGCAGCGGCCATCCATGGAGCAAGTTGTGTCCAGGCTGGAGAAGGCTCTAGAGATCTCCATGAGA
GATGGTGCGAAGCACAACAGCATTAGCATCATTGAGTCCATTGCATAGCTATTCTATGTAATCCTTAAGTCCCTTGATGTCCAAGTGACCATGCTTAACATTTCTGTGCACTAAAGTGAA
CAGAACCAGCTGAGTGGTGAGCAATTTACATCAAAAAATTTTAAGGCAAACCGATCAAAGTACTTTACGCCTATAACAAGGGATAGTTAGAGACTAAATCTAGAGACGGTACTATCCAGA
CTTATAGTATGATGCAGTTATGTAGGCTTGGACATTTCAGCTTCTTTTCTGTCACACTATACAGATAAGTGCAACTACTGCAGAGGAAAACCAATAAAAGGAGATAAAGCACGATACCTC
TTAGAAAAGACAATGACCAGATGATGATAGTGAGTTTAATTTAACACTTGAATTCACTACCATGGTCCAGGTGAATATGCTCTCTTTCAACTTACTACAAAAGGAAACAACGATAAGTAC
ACAAGCCACAGTAATTAGCTTGGCAGACATCATCACTTTGCACCCACTAGTGCCAAATGAAAAAAAAAATGGCATGGGTGCCTTGAATACAAAACTGTACCAACCATCCCCACCAATCGA
TGAAAAAGATGGAATTGTTTAACAACAGAACTCAATGTCATCCATAATACCAACCTCCGTTTCCGTTTATTTGGCAACTTTGACCAAGGCACAAAGCTGAAGGCAGTTACCAGTTTTAAG
TGGAATGACGAAAATACCCTTAAGTTAAAAACTGTGGCCACGTAAGCTGAATGGGGAAATTTCTGGAAGAAACTAACCAGCCATGTAAGTGTCGTGCGGGGTCTGTCTTCTTATTTGAGT
TTTCCTCTGTTTTCNNNNNNNNNNNNNNNNNNNNNNNNNGGTTGATGGTGGGACAAGGTGGGCCATACTAAGGGCAAAATTGGAAAACAAATCTTGGGAAGCGTGTAGTGTCAAGTATTT
GGAAAAAGGAAAAGTGGTCAAAATTGACAAGTATTGTGAAAAGGAGTTTGGTACAACTTTATTCTATAACAATATATGTTTGCAGCCTAAAGAATTACAGGGCTGTAGATAGGTATAGGT
GCACTAGCAATCATCCAGTTAGTAACTAATCTAATTACAACATAATGCAGAAACCAGACTGTTACCGAACTGATCTTCTGCAAATATGGAAGAAAAATGCACAACAAAAATACACATTAT
CGAAGTGGCAGTTCATTGAGTGCATCAGTATAGTCCTTTTTGTTCATCGAAAGGACGCACAAGCCATGAGGGAGAAAGAGATATATGGCAAGGAAAATTATCACTCCGAGATCAGCTTCT
TCACCTATGGCAGGTTGAGAGGGTTGCCGCAGGTATATCTGACTGGCACACCACATACAGTACAGGGTGGCTATCACCAGGATGAGAAAGAAAGATTGGTTTGATTTTTCTGCTGCAGAC
TTGCCATGCTTCACTCTGTCAAAACAAGGAACAAAATATTACAGAACTGCAACAAGGATTTATAACCGCACATTATTTTTCAAAAGGGAAAAGGTTTTGTAAGAGCATGTATAAGCATTT
TTTGTAGCGTAATCATCATGTAACATTTGTTGGCCATCAACAAAGATCAGCGTGTAGTTCTTTTTTCCAGAATACACAGAAGAACAGCGTATTTTTGCATAAGAAGGAAGAAACACAGGT
TCAAAACTGTAGGCTGCTCCCTTGCAGCCTGCTCGCCAGAACATAAAAACTGTCAGAAACAGACCAGTTATACAACAAGCACACAGCAAAGAAACAGAATTTTGAATAATCTGACGCCGA
CACTTTTCCCTTTTGGGGTGATGGGGATTACCCATTTCCATTCATCACAAATGTGGAAAGAGTGATACAACTGAACATACCCAAGCCGAACATCATAAATCTCCATAACAAACATGATAA
TGAAAAACACAGACAATAAACATAAATTCTAGAGTTGTGGAGAAAAAGGTTTTCCTTTTATATTTTAATAATGGAGAGAACTATAACTTTTATAGATAATAAATTAGAATTACTTGTTTC
ATATACAAGGAACCGAGGTTCTAATAACATTTGTAGCGGCATAGTGGCGAGGTGCCAAAGTATGCTGCACCACTTGTAGCAGGCATGTACAGTTAGCTACTTATTTAGAACTTTGCAAGG
AACATAATCTAGTTTGTGTGTACCACTTTTTAATTTGCAAATAGTGATAGACTGATAGTGCACTTAAAAAGCCCTCACCTGTTGATGTACACAAATATCCCCATGAGGCAAGTGCAAAGA
AGTCCTACAACGACCACTGCATCTGAATTGATAGGAGCACGGCCTTTCCACCAACCAGTGCTCAGGATCCAAGTGTACATTCTAGAATGGCCATTCTCCTGCAGCAGTACAATCTGAACT
CAGTAGGAGAAAAATGAAACATCTAGTTCATTTGTGATCGGAACAAATCTCCAAACTGTTAAGCACACATTCTTAAAGGTTGAACACCAGTTCTAAGCTAATGCATCCTCCCATTCACGA
GGAAACATTCCTTGCTGCTGCATGCTCACCTCAAACAAGTGGTCCAAGAAAAAATGAGACAGCGAGCCGGCCGAGATAAGCAAGAAGCACTGCCTCTTGTTTAGTGGCACCTGCAACAAC
ACCAGGATTAAACAAATCAGTCACGCAACACTAGATTGATATGGAGGCTTCTTTACTCTGGAGCTCCTTAATTAACCCTTTTCTGCAACAGAGGATTAAGATAATGCAGCATTACTAGAC
TACTAGACCTGACATAGATACCAATTTGCTATCTGGGGGGTGAATACCAATTTGCTAGACGCCGCCGTACGGAACAGTAGATTCAGAATGGCCATAGCAAATGAGAGAATCAAACGTTCC
AGCACCCACCCCAGCGGCGGAGTCGAGGACGCCCGCGCGGAGCAGCCGGCGGGAGAGCCAGGCGTAGGCCCAGGCGAGCGGGAGGCCGAGGAGGAGCGGGTAGTAGAACGGGTGGTGCAC
GGCCGCCATGGCGAGGTCCCCCGCGGCCGACGCGGCGGCCGAGGACGGGAGGAAAGAGCAGAGCCACTCTGCGAAGGAACCGAGGTCCGGGCCGAGGAACGCGTTGGCGGCGTAGACGGC
GCAGTGGTGCGGGCCGAAGCGGCGGTCCCCCGGCCCGGCGAGCCGCGACAGCGCCGCCCCGCCCGACAGCGCGTACAGCAGGTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNTGGCTGCTGATAGTGTGATAGGCTGGCTCGGTGGATCGGTCTCCGCCGGCCGACGGAGGCGTGGCGCGCGGTGGAGTTTGGTGGTGCCAGAGCCGAGCCGAGCGGAGTAGGCAGACGG
CGACGGGGTCCGGGTTCTGGTTTGGTGTGAGCTTTGCTTTGCGTAATCGTCTTCGTCTCGCCTTCCTGTCCTGATCTTGCGGCGTTTCCTCTTTCACGCGGTTACTGCCGGCTTAGCGCC
GGCCCCGACGTAACGGTAAACGGTCAGGTGGTTCGACTGGGACACAGCTGGCTCGTATTGCAGGTGTTTTAGAGGGGTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAGTCCATATTTACTACTGCTGCTTAGTATTTAAATATGCGATGAAGCAGTGCCAGAAAGAAACCTAGTAAATCAAGCGTGCTC
CCGCGCTAACTGCGCTGGTATCCGACAGGGGCGCTATCCGAGTAGAACGACGCGAAGAGTACGATTACATCGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGTTCGNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCAAAGGGGCCCACCAAA
CCGCCTAAGCTGTAAACGCGCGAGCAAGAAGCAACTGTGCTTGCAGTTTCCTGGTTGCTACACGATCCCCAAGAGGTCAGAACACGTCGATCCCCAGGAGGTCAGAACACGTCATCAAAA
CTCAAAAGAGTGCCAAGCAGCCGTCCCAACTAACCAGAGAACGAGGCCCTCGGCATCAGGGGCGGATCCAGCAGCGGGTCGGGTGGGTCAAGGGGCTCAAGCACCCTACTACCGTGAATC
CCACGGATCTCCCCTAGCTCCCCCTACAAATTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTTCCCCTAAACTTCAATCCAGCATTTGCCG
CTGCTTGGTGTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNTTACGTAACAGCTTAGCTAATCGTACCTGTCGGCTGCCTGGATGCTCTGAATATTCCATCCAGAGTGCCTGAGATGATGATGGAGCATGACAGGCCATTAGCAATGCTGGATTAACC
GCCTAGGTAGCCTCTTGGAGCTTTTAAATTCATACTCCCTCCTTTTAAAATTTATAAAACTTATTTCATCTCGTTATAACAAGTCTTTGATCAAGAGTATTTAATCTCGTTATAACAAGT
CTTTGATCAAGAGTTACTCTATGAATGCAATATTTTTTATGACACAAAGTTGGTGTCATTTGGTTCTTATTCAAAAATATCTGCTTTGTGTTTGTAATTTTATATCAAAATAAATAAGGA
AAAAGTTCAAATTAGTACCCCAACTATGACCGAAGTCCACATAACCTCTAAACTATAAAAACCATTTATTTAACCCCTTGGATTTAAAAAATCAGCTCATTTTCCACCTTTGGCACTTAA
CTAAACTGGTTTTCACCGCGTGGACAACGGTTTTGTTTATTTTGATGATTAGAATGGCCACGTCATCTCTTCTCCTCTCCCATCCCTGCTGTTCTCTCATGTTTATTTCTTCTTCCATGG
CAAGCCAAAAGCGCTTGCACAGTTAGAATTATGTAATCTTTGTATACAAGCTGCAAGACACAATTGTTTCGCTCGTCAGTGCAGCCCACGCATGCCTCGGTCCCGTCGGCCACAAACGCG
CCGCCGCCAGCAGCTTGTGCACGTGCACGTGCGCCAGCACGAGGCACCACAAGCCTGAGCAGGAGCCGCAGCGCACCAACCACCGCAGGAACTTGCAAGCTCTCACGGTCTCAACAGAGG
CATAAGCCGACGAGGCGGTCGTGCGCATGATGCTGTCGTGGCCGTAGTTCCCCGTGCCGGATCCGAGCACGACCGAGCGAGCGCGTGGCGCGGCCGAACGGTCAATAATGGAGCTCGTGG
CGCTTCCATTCCCGTCAGCGCCGCATCCCCCGACGCTCCTGGTGCTACCGCTGCCGCTAAAGAAAATGATCGAGCCACATCCGAGCTGCGGTGGCCGGGCGGGCCTGGCGGATTGAGACC
TTCAAGCTCATCCAAATGGTTACCCTGCCGTGGCCTCTCCCAATGGCCGCCGCAGCCGCGTTGCCCCGCGCCGGCAACTTGCCGTACCCGGGCGATGAGGATGAAGATGAAGCCGTCGCA
ACCGGACGCACGCAGCGGCGAGAGTTGACTGCGTGAGCAACGCAGCACGCGGACCATATGCTCAGGCGCTCAGCCTCAGCCATCACCAGAGCTCGGCCATGATAGCTGACATGAGCAGCC
AGCCAGCCAAGCACTGTCCAGGTGGCCAAAACCATTCGCATGGTCAAAAAGGTGGTTTCAGTTGGATGCTAAGGGTGAAAAATGAGCTAGTTTCGTGAATACAGGGGTTAAGTAAACGAT
TTTATAGTTGGAGGGGTTATATGGATTTCGGTCGTAGTTAATAAATATTAAAACCATTGCCACACCTTGTTTAAACGAAACGAAACAGGCCTTCTAAAGAAGAACGACGCCTTCATTCGG
TTGCGTCTGCTCTGATGGCGGAAGCTGAAGCACTCAGAGATGGAATACGGGACCGAGTGCTAGTGGAGACGGACACTTAGGAGCTTGTGGCCCTTTGGCGATCACGTGGGAATGACAGGT
CCGAGATTGCAGCAATCCTAAATGATATTCAGGAACTATCGGCGGGCTTCACTTCTTTCTCGATTGGCCATGTGAGGAGGACGGCCAACACTGTTGCTCATTTGTGCGCTAGATACGCTT
CTGCCTCTAGTTTAGCCGCTCTCTGGGTTGAACAACCCCCTAGCTTCTTGCAGCTATGCCTGCTTAACGATTGTAATGGTGCTGATTACTTAATGAAGAAGCTATGTTCCAAAAAAAAAA
AAGATATATCCAGCTACCGGTAAAATCACAAAGTGAAACCAAATGGGATGGCAGATCATGAACTTCCCACAGAGTACGGTTGTTAGAGCTCTGACAATCTGCACCCGATATTTTTTTACA
GCACCCAGCAGTGCATCTTATTAGCTTACGGTCACACAGACAGTCCAGATTACCACTCGCATCGCAAGTTCACTTCACTGGCGCACCGCGCAGCGGCACTTCCGTCTAGGCGTCGCAGTC
CATCGGCACGGCGGCGGCGTCTTCCACCCGCTTGCGGCACCTCCTGGCCGCCTTGACCGCCAGCAGGGTGTCGCAGGCGAGCCAGGGGAAGCTCCAGAACCGCTTCTCGCCGCGGCGGCA
CGGGTGGTACGTCACGTGGTACCACGCCGACGCTAGCTTCGACGCGTCCTCCTCCCTGCGCGCCCTGAGCCAGCCCCTCACCTCCTCGTGCAGCGCGTCGACGGCGGCGATGATCCGGTC
CTTCATCTCGAAGTAGCGCTTGTTGTCGCGCCGCAGGTACACGAGCTTGTTCCGGATGTTGCCCGTCAGGATCTCGTCCTCGCGCTCCGCGGAGTAGTAGGTCATCAGGGTGCCCAGCTT
CTCGGCGTAGGCCTCGTAGTGCTCTTCCGCGGCGTCCAGGAAGTCGTGGAACCCGGGGCACTCGAGGTCCGGGTCGTACTCGGAGCACGCAGGGCCCTCGGGCAGGAGCGCCTCCGCGTT
TTCCGCGTGGCGCAGAGCTGAGCGGTAGAGCTTGCCGAGGACGCCGTTGGAGACGTACATTGGCTTTTCCCACCGTTCCATGAAGTCAGGGAACTCCCGGGGCCTCAGCGCCCGGGGCAT
CTCGGCTGGAGCACCTGTCTTGGCGAAATCAACCGCCATGGAGTGCAGAGCGGCCAGCTGGAGGCACTCAGGGCTGCGAGCTTTCAGCGGATTACGGTCTGCGTGGATCAAGTGGGCGGT
GGAGATAACACCGAGGGCATCATTTATCATGTAACTGACGAAGTGCTTCTGGATTTCCTGCATTTCAGAAGTTCTTATTGTAACATTTTCACTCAGGTGATAATAACCATGCAAGATGGA
AATATTGATACAAGGGCATTTGTTAGAAGTGCATCGTGAGTATATATACACTTGGTTCAAAACATTCAATTTTTTTTCATTTTCTGGTGTATTTTCAAGTACATTGATTACTTCTACATG
CGGATGTGCATACCATCTTAATACCATTCTGGCTGGATAAGAATTTGGAAGTTAGCTACCAGTTCTATATGCTCGTTATTGACATATCAGCGCATGTTTCATTAAGTTCGTGCCCTAAAT
ATATAAGCGCATTTTAGAAACAAGAAAAGGTTTCTCAGCTCCATCTATATCATTAAAACACTACAATCCATTATCTCAGGAAAAAAGTTGCAGCAATTTTTAAACACTTAAACCTTGGTG
ATATTTGCTGCTATAAAAATCTGATATTAGCATAAGGAAACTTCAGGTCTTCAGCAAATCAACCACAGAATTACATAGTCAACAAAAATGAGTGAAGAAAAAAGAATACACTCAGGAGTA
TACCTCAAGTGTAACAACATGGTCCATTATGCGTGGCCTTGTTGCAGTGTAGTCCATAGGTGCATCAACCTTCTCAGGAATCAGTTTGTCATCCCAAGTAATAAAGAAGAGATCGCCATC
CAAATCACCACCGGAGCATTCATTTGGATGAGGCCTAATAAATTTGAAGATCAGTAAGGATAGTGCAAGCATTGATGTCATTAATCTAAAGCAAGGATAGTACAAGCATTGACAGCATTA
ATCTAAATACTTAGTTGTCAATTACAAAACTGGAAATCAACATAATATGGATAACATTGCTAGAAAAGACCAGTGTCTTGTTTCAGTGAAGAGGGCTGCTTCACAGCCATGGACAAAGAA
ATTGAACTGGACAAACCTAAGATAGTCATCTTTCAGCTTCAGAATAACGTACCTGTCCCCTCTCTGAGGAAATACAACACAATCAACAAGGCCCCTAGCATCCAATCCGGGATCATATAT
AGCTTCAAGTACTCTGACATCACCAGGATGGAGACATGGGTTTTTTGAGATTGCAACTTTTCCAACAATTACAGCTGTTTTGCCATCATCATTACAGAAGAATGGCTGCTCACTATACTT
CTGCTCCTTGCGATTCTTTGTAATTCTAATGTAAACTTGACCATAGTCTAGTTTGCTTGTTTCATCCAAACAACCGATGAGAACACGGCCTTTCTGGACATGAATCTTACACCTAGTTCT
TATGTCTGTCAGCCTGTTAGCCCGATGGGCTTTGAGAATCATTAACAGGTAAGGCTCTGAACTTGGTTCATAGCCTTGCAGCAGCATCTCAGCTGCTATCTTGGTATCTGCACCACCAAT
TTTCCCTAGGACAGACAAAGCAACTTCTTTGTTTGTTAGCATTTCATCTGACTCGTGCATGTCATCTTGTTGCATCGACAAAAATATTTCATCCTTTATACCCAATGTTGAAAGAAGAGA
TATAATTTCACGATTCACGTAGCATGGCTGAGACTTGCTCCAATTTGTGATGTTCAGCATAGTGCTTTTTGATTCGAACTTCTTCATACTAGGTCGCAGAGAAAGATTGTAAAAGGAAGT
AGGATCAACAGCAATGACTCCTTTATAGCCACCATACCTTATTTGAAAAGCAGAAGGAGGGTTATTAGGGTCTAATCCAATTGTTTTGGCAATTTGTCTGGCGAATCTCGAAGAGATCTT
TCCAATACCATCAGAAAATATGTATTTATTGCCATCAGTTGTGACTTCAATATCTGGGATTACTTCTACATCATATGATGAGACTTCGAATGTCTGCCTGGAGGAGCTGAACAGCTGACC
CATTCGAGCTGCACACTTGGAGACTGAACGGATATCATTGAAGTGGCCCATCCACCTTCTTATACTCTCAGCACTCAAAGAATCATTTGAAGCAAACATCCAAACAGAATTACCACGAAG
TTGGCTTGCTGAGAAGGCCAAAAATTCATACTTCTTTGGGCCAATGCAAAATCCTTCTTTTAGAATAGAGAGAATACGATGATACAGGTCAGTTTTCAAGGGGGTAGAAAAGAAACCTTG
TTCGATTCTAGCTGACAATGCATTGGGTGAAAGCTTGCTCCAATCTTCATCAACAAAAGTAACTCTAGCAAAGTCAGAAGCATACTGAGAATGGTACTTAACCACATAATTTGAAACTTC
TTCCTCAGGCCCCAAGCAGTATATTTTCGATGGTGTGATGTGAATTCTGTAACACCTCAACAATTTTCCTTCACCTTCACCCTTCTTGGACAGCAAGGTTTTCTTACTAATCTTCATCCT
GTGAGCCTCGTGTCTGATAAATTCCAAAGGTTCATAACAGGTAGATTTCAATTTGCTCACTTTCTCAAAAATCCTCCTTAAAGTACCAATTGGTAAATCTTCGAGCACTTTGAACAGATC
AGCATTAACATGCCTGGCCACTAGCTTCCCCATGTGAACAAGAGAGTTCAAACGAAATAGAATTTCATAAGGTACTGAAAAGCCACTTGGGCAATCAACAAGAGGAACCACTTTGGAGGA
GGAGCCAAACATATCCATTGAAGAAATGGCCAATTCCCCCAATTCTCCTGAGAAGGGTAAACTTTCAAGAATATCTGACACTGGGGCACCTTTGCTCAGTTTTAAGACAAGAGTGGAACA
CTCCCCAAAAGAGCTATTAGGTGTAAAATCTAGTGCTCTGACCCATGCAAACTTGGCATCCTCCTTGCATGCATGAAAGTGCTCATCTGTGAACCTTGATTTAATTGTAGAGCCAGAAAT
TGCAGTGTGGATTCTCGGTGCATAGGTCAGCTGCAACAAGCATATAATATTTAATTTACCAGACAAGCTTCAGATTCATTAAAAACAGGCCCAAAGAATATTTGCATCTGAAAGAAACTG
ATAGCCTAAGAAATATGACAAGCACTAAATCTATATCACTGCAGATAATGTGTATTCACCAGGACAGCTTGATATTAATGGTAAAAAAATTGAAAGAATATTTCNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNTTCATTTGTAAAGTCTACTTAAAATTAGTAAGTGACCAAAGCTTAAACAGTTCCCCTCCCAATTAAAAAATATGAAAAGAGTTCTCATGTAATCGGATCCAAAA
AAACGCTTGAAATAACATGTAGTGGAAACTCAACTGATTTGCGCAAATATTAAGTTAATTGTCTGCTTCAAATTTAAATATAGTATCCTGTATGAGGATTACGTTTATTGTGCATAGCTC
AGGTCTTTGAGTAATAATTCAAAACGAAAATGGTTAATTTATGCAATAAATGTATGTATGTATTTATTTTGAACGCTGCTACACTATATACACTATAGCGCCCATGGAAGACTCTAGCAG
GTAGCAGCCCATATAGGACTGAAACATCATCTGTCTCTGTGGCACGAGTCTGTCATACTCTTATTCTGCTAGGATATTAGGCTAAAATTGAGGTCCAATATCTGTAGATTCACTTGCTGA
CTTGCAACTCTACGCATATTGAGCTAATTCTAGCACAAGCACTCGGCCATTCTCCTGGCTACTGAGTGAAAATAAGGAGATATCTGCTTGTAGCATGTAATCTATTAATTCAAAACAAAT
AATCAGGTCGCACTCAGTTTCACAAACGGGCGCATCAAAGTTCGGGACTTTCTGAATGGAATAGCACGGTATAAGCAGCTCACCTGCAGCAAGATGGCGCCCGTCCCATCGAAGCTGCAT
CCGAAGCACTCCCTGATGTCCTCAAAGAGAACCTCAAGCTTGTAGCTCCGGGAATCATGTTTCAGGTAGAGGTCCACGCGCCGCTTCGCCGGGATGATCTCGGCGCGCACGCCGTCCCAG
GCGTAGGCCACCTCCAGCTCGCGCTCGGCGACGCGGTTGCCTACAACGAGGCTCGAGCCGAGGGCGCGGAGCGCGAAATCGGGCGCGCGGGGCAGGAGGTCGACGTGGGCGGGGGAGACA
GAGAGGCGAGAGCCGAGGAAGGGAGGAAGGCGACCGGAGGAGGCGAGGTCGACTGCGCGGGTGGCCGCCGCGGCGGAATCGAACTGCACGGACCCNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCGAGGGCGGGATGTTGGATACCCGCACCGTGGCCGTN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNAGACATAGCGGCGGGGGACGGAAGGGCCGGGATTCCGGCGATGTCACGGCCGGAGGTTTTTGTGTTACAGCCTGAAAAGAGGGTTTTGTAA
ATGGGGCAAAAGGGCTGCAAAAGCCAGTTGTCTCTGAATTGATCATTTTCAGATTCTATTAATAATTTTATAACATTTAAGGTAGATGTTCGGACATTGAGAAAAAGCTGAATAACACGT
GAATTATTGTCTAACTCTCTCTAACCTTAGCGATGCACACGGTTAAAGTATGCTCATCCGTATGCATCTTTCATGATATTCTCTAATTTAGACTTCTTCCTAAAAAATCCTCAAGTTTCA
AATTTATTGTCACGTATCTTCCACTGTTAGGACCGACTCTCCCTCCTCCCTCACCTTAATGTCGATGGCATTCGCCCTTGCCTCTGCCATCGTAAATCCTCCCACATCAACTTAACGTAG
GTGATTGCCCTCGCCCTCCCTTGCCCAACTAGTTATCCACTGCCGTCTCCAAACGCCTCGCATGATGTTGCTACTTGCCACTCTAGAGCTTGTTCCATGTTTGGTGGACACATGTACCTT
GGTTCCTTAGAACCACAAACCCTAAAAGCTCATCGATGCTCGCCGAATGTAGAGAAGGAGAAGAAGAGATATGAAAGAAAAATTTGTGTGAGAGAAGGACAAAACATTCGGACGTGATTT
AGCATTTCCCAATATAATTTATGAGGTACTTTCCGCATAACTAGTGGTGAGAATTTCTATGTAGGTTTTTTTTCTTTTTCCCGATTATTGGATCATAGTAGACAAATGAAATTAATTTTA
ACTATAGAATGTTGTCGTAGTTAGTGCATCCTACAAATTTCATAATACACTTTGAAAATTATTTTTTAACCTGAGCATTGCTGCTTTTCTAATAGAAAATGACATTTTCTAAGGCATGTA
CACTCTATGGTCCTTAAGATAGCTAGTTTCCGCTACATTTTGCATATCGTGAAGTAGAGAGAATTTCATTGGGTAAATCGCTATCTTGTGTGGGGAATGTGTCAACACTTGCATTGTTGG
AGAAACCATTTTTATTGTCAATTATTTAATTAAGTGGAGATACAAATAGCTAACAGGTTAGCTCTATCTATCATTGGAGGTGCCCTTTACAAACTTTCGAAATTAGTTTTCAGAAAATTC
TAAGAATAGTTTTTTGAAAAAAAATAGAAAACTTTTTAGGGAAGCNNNNNNNNNNNNNNNNNNNNNNGAGCTATAAAGAAACTTTGGGGGGGGGGGGAAATTTTCCATGAAAAATAAAAA
AACAAAGAGATAAACAGCCCGAACGTCTACATCTAATGATAATCATAGCTACATCGGTGCTGTAATCTGTGGAGTAGTGAGTATAGAGTACTAACGTACTGATTTCAGAATTTCAAATCA
CATTGGTGCCGCTGGCGTGATGACTGAACCACAGGGAGTACCGGCAGCAGGAGGATCGAGACCGTTAGTCCACAACGCCGGCCACGGTGGCCACTTGTTTTTCGTTCACGGTTCATCTGT
AACGCGAGAACAGGGAGGCAACGCACGTGATGCTCCTGCTGAGAGCAGTACAGGCGGTGGAACATACGGCTTGAATTCTTCATCTGGCAAAGTACCTGGTGACATATAGCACCGTCTGGT
TTGCAGTTGGCACCAGGGTCCAGTTTGATCGATTGGCTCATCCCAAGTGTCCGGACTCAGGAGGAGTGGCAAAAGTAGGCGGCAGCGCTCTGATCTTACACGCGGTGCGCGCCCCTCGGG
TGCGCGCGCAGCTGCTCGACGGCGGCTCCACCTCGGCCTGCTGCGCTTATGCGTGTTGGCACGGTTGATGCAGTGACGCGAAGAACTTTATTGACTGGGACCAGACTGCAACCTGCAGAC
GCACACGATCGCTGAATCGCCGCAGGCTGCAGCGACATCAACCGCGGAAACAAGGACACGACCACCCATAACTACCAAACCAACACGGACTCGGACACCACCGCCACCACCAACGACGAC
ATGCACTAGCGCGTGCTAAACGACTGCGATTTCCGCCTCGGCGGACGGAACGATTTCCGCCTGGTTCTTGAGTAGGTAGTCGTCGAGGTCGTGGAACGTCTTGGTGGCGGTCTCCTTGAT
GACGTCCGGGTCGGGCACCTGCTCGCTGGCCTTGTCGAACTCCATGGACCAGTTGACGACGGCGCCGGCCTCGCCCTCCTTGGCCGGGGACACCTTGAGCGTGATCTTGAAGTTCTTGTA
GAAGTTGACCAGCTCGCCGTCCACCACGCTGTACGACACCACCCTGTTCTCGTCGTCGACAAGCTCCACCTTCTCCTTGGCGAACGTCAGCATCGGCACCCCTGCAGCAGCAGCCAGCCG
CCGTCGTCAGCATCGTATCGACTAATCGACACCACCTTGTATTGTAGTAGAAGTTGACGGCCATATATAGCAAGAGGCGTGTCACGTACCCTCGGCGTACTTGAGGAGGCGGACGGTGCC
GGCGGACTTGCCGTCGCCCTCGACGGTCTCGATGCTCTTGTACTGCTGGGGGAAGATCTTGGGGAACAGCTCCGTCGAGTCGCGCAGCGCCGCCCACAGCTTCTCCGCCGGGGACTTCAC
CTCCACCACCAGCTCGGCCTTGGAACCCATCCTAGCTTGCAGCTGAGCTCTACCACCTCCTATGCTACGAACTGTGCAGGTGAGTGCTGTGCTCGTGATCTGGCGATGGCGAGACCTCGG
CCCGGCCTTTATATAGAACCAGAGAGACCAGCTCTGACAGTGACTGCTGTTCTTCAGAGGAGACGCAGGCAGCTGCTACTGCTGCCGGCCATTGAAGGTCTCCCGGCGAGATCCAACCAC
CTTGCTCAGGCTCGATTTATAGCGTCCGTCGGTGCATCAGATCCACGCCGTGCAGCGACGCCGATCGCCGATTGATGACGGTAACATGCACGCGCCGTGCTCTCGCTGAACTGTGAGGCT
TATTTTTTCAGACGAAATTGAATTGTGAGGCTCACTGGCTGCACAGGTTGGATCGGAGTGATTGGAGAGATTCTTTTGATCTGAAAAATTAGATGAGGCCGGGCAGAAATGGAATGGTCT
GGTTCGCAGTTGGCTCCGGTTTAATTGTTCGGTCTCGGTTGGAACAGTAAGCGTCTGTCGAGGTGCAGGAGCAGTGGCAAAAATTGTACTCTGATCAGAATGCACGGACAGCGACGGGTG
CCAGCCAACTGCAATGGCGAGCCGTTCAGGGCGTGAGTTTATGTGCTCGGCCAAGCCGCAAAAAGTTGTTGACGAAGGCCTGTTCACGGTGCCAACCCGTTCAAACCGGCAAACCAGACC
ATAAACCGACTATGCGATTCCCACCGGGTTGGGCTAAACCGGGTCTGAAACCAGTCAACCCGCTGAGAAAGTCCGTCGCTAAACTCATTAGCAACCAAGGCAGCTACGGCACCGCCCCGC
AGTCTAGCAAGCGAAGCGGTAGATGCTCGAGCTGCGGCGGCAAGAGTCTCTCATAAAGCTCGCGACCCATCACATCTGTATGTTTTCTCCTATTTTTGATCTATTCCTTTCTTTCGTTGC
ATTGCCTCCTGCGCTGGCAACTAAGCAAGGTCGTCGAACAAGCATGCAAGCAGAGCTGGACCTGGAGGATGGGCATGCTGTCATTTGTTTCTGCAGTGAGGTTGTTCCTGCCGTTGCCGC
CGAAGATGCTAAGGCCACCAGCCGTCTGTTATTGGCGGCATGACTTCAATTTCCAGCACAGCGAACTCGTGGAGGCCGCACAAGCGCTGGTACTTCAATTCCTTGCGAGATAGAGATCGT
GGATGTCGCTCTTCTTCGACTTCCGATGGTGTAGACGTCGCGATCTCGAACGTTCGCGACGATCTACTTTACCTCTGGTTCTAAACCGCATAGCCTGTCAAACCAACCCAGCTAACCCGC
AAACGTACGGTTTGGTTTAGGAAATCACCCTAAACCGCGTTAAACCGCCATTAAACACGCCTAATGAAGATCCATTTTGTTGGCAGTCTCGGTGCTCGCATGAGATTGGTCAGTATTCTG
AACATCATCGCCCGATATGGTTTGTGCAGAGGAAACGTTCAGATCAAAGGGAGAGGAGGGCCTTCTGTTGTGTCCAACAGACAGCAGCACGAGGCAGCTGCTGCCGACTGCTGTTTTGCT
CCTGCTGCTTGCACGGCAGCACCTGGTGTGGCGGTTGTGCACTTGTGCTTATCGCTTGCACAATGTGTTTGTTCACGAAGAGTTGAGTTTTTCTTTTTACATTTCTTGGTCTCAGGCTCT
CAGCTTGACCTTACCTTGTGAAAAAAAAAGGAGTTGAGTAAGTTTGGCAACTGCTCACCGATGTAAGAACTTCTAATTTATACAAAGTTCAATTATTTAATAAATTTGAGTAAGTTTAAA
GAATAGTGTTAACATCTACCACGTTAATTAGAGAAGTAAAGTATAGAAATAAATTTTATAGCGAAAGAATGGATCTAATGATGTCCATTTGATATCACTAATACTATTTATTAGTCCTTT
CTGTACAAAATAATTTAACTTAGAATAAACTGAAACTCCTTACATTTATGTATATAGGGAGCATTTGTAGCGGCTTTGATGGAGGGGCTTAAGATAGTAATTTGATTTTTAGTCTCAGTC
CTTTGTTTGGTTCGTGGAGGAAATTAAGAGGAGAAATCCTTCCCTTTGTTTGGTGTATATGGGTTTTGAAATGAGAATTTGTATCACAAGTCACCATGGAGATGCATTCATCTCCCACTT
CAAAGCAAAATTTCCACCCCTCCCTATCCTATCAAAACTCACACCCTCACCAAAACAAATTTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGCGGCCGGGAATACTCGCGTATCGTGAGAC
CGGACCTACCCGTGTGCAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNG
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTAATCGAATGTCTTTTGTTTTCC
CCTCCTACTAAACTTGGGCCAAGGACCCCATAAAGAAACCCGGCCCAAAGTCGTCAAAGCTAGCGGTACCACAGCTCAGTCACACACAGTTGACGTTTATCCACGTAAGCCGCTTTAAAA
AAACAAAAAAAAATCGCCCCTCGAGTTCCCGGCTTCCCCATTCCGCTCCGCACTGGCATCCGCGTTCCCCATGGCGGCGTTGCCCGCCCTCGTCTCGCTGACTCCCGCCGTCTCGAGGNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNAGCTCGACGAGCTCGCGGCCTTCCGCTACGAGCACGCCTTCCCGCACGGCCTCCTCACCGTGCGCGCCCTCACCCGCGGGCCTGAAGACGACGCCGTGGCCGAGGC
GCTCGTCCGCCTCCTGGCCTCCTCGTTCTCCGAGACCGTGCGGTGGGCCCCGGCCCAGCGGTACGCGCAGCTCCTCACGTTCGTCATCCGCAGGTACCTCCACGAGCGCCGCGGGCTCGC
GCCGCACGCCGCGGTGCTCGTGGGGTTCTACCGCCCCGCCGACGCCGCGGCCGACTCCACGGGGGATGACGGAGATGAGGGCGGCGAGGATGGGGAGGGTAAAGATGAAGGGGAGATGGC
GTGCACCGCGGAGGTGTCGTTCAACGCGGTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCGACTTCCCGTACATCTGTAACATGACTGTGAAGACGGCATTGAGGAGGTA
ATGGATAGCATTGTAATTTATAGTGCTCTTGGTCGGCAACCAATTTGCCTATTTCTTCTGGAAAACAAATCTGATGCAAGAGTTGGTTGCAAATTGTGCTTCCTTATTAGTTGTAACTTT
TATAATGTGCTATAAGAAAATTTCTTTTCACCTGTGATATAAGCAATTGGAAGGAACCTTCTGGTGCATGATGCAGATTCTTTATATATAAGATCAGTCAGATACTCTGTTGTTCAGTGC
CATATCAAGTTGTTTGTTCATATATATATATAATATGTCGATTATAGTGCTTTCTAAAATCTGCCTTGTTTTTTTCCCAATAGGAGAGGACTCGGGAAGCAACTTCTCAAGGCATGTGAG
GATTTGGTCATCAAAATGGATGCAAGACGATGTGTATATCTTCATTGTAGAGTTATCGATCAAGTGCCGTTCAACATTTACAGGAAAGCTGGATATAACATTGTCCAGACTGACAGTATT
TTGGTTTGGCTGAGCCTTCAAAAGCGGAAGTATTTGATGAGCAAGGAATTACCCCAAGCTTCTGCTGTTAGTGAGTCTACAACCAAAGACTTCGATGATAATATTTTGACATGCTAAACA
TTCAACAGGATCAACAGGCACACAAGAGGTTAAATTTTGTGTATAAATGTATGGTTCTGTTTCATCACACATTTTCGCTGTTGTATAGCTTGTGAGGAAATCAACTGCCATTCATTGATT
GTCTATCACAAAATTATTTAGTTGAAAATGAGTTGACAAATGCTTGTAACATATATTGATTCAATAATATAGCCCATAGGCTCACTAATTATGTAGTTTAAGCATTTATAACATATCATG
ATTCAGTGTTGTAGCCCATACAATCAGTGAGTGGAAGTTACTTCACTAACTGATCTATGAATGAAATTGCCAAAAATATGGATGGGAGTAGGCTAAGTTTTTCATCCTTTCAGAACAAAA
AAAAACTTACTAACATAAGAGAAAAGACCTCCTGGCCGCTAAAAATCAGGCTTGGCTAATTTAACTTGCCAATGTACTTCAATTTTTCATTTTGCATCATTGATGATTCTGCAAGTCTTT
CCTGTATTTTTGAAGCAAAGAGAGTAATAACTCATTCCACATATCTATCGGTCCTGGCAAACACCAATGGGAACAGTCACTGTAACCCCTCATCCACTTATTATTCCAATGGATCCCTGG
GTGTGCATCAGGCCTCGTAGACATAGCTTCGGTAATGTCTAGAATCTCTATATTCATCCGTCCCTTGTGGCTGATTTCCTTTTGTGCTCTGTTAGCTTCCTCAACCTGAGCGTTTCTTAT
TGCCCATTCAACTGTTCTGGTCATTGCTTCTCCTTTTCCCACCGGTTCAGTTCTATTGCAATATCCTCCAGTGTTCCAGAAGCCATTCTCAAAATGTGCTGGTGTTGCTGTTCTTACTAA
TGTTAACTGCAATCCACGTTCTTGGCAGTTGGTCAAGTTATTGAGAGCTGTTCTAAGAGCCCTCTGAATAGCTGTAATGACATCAAAGCTTTTGATGTTATCCTCTGAGCAATATATGCA
TCCAATGAGTTTCCCACCTTCGTAGAGATAATTTTTCCTGAAGAACCATCTGGAACTCGATATGACTAAAATATTGATCTCACGTAAACTGGCAGCTAATCTTGAATCAAGTTTATCCAA
GTGTATGTCATGCATTTCAACCAGTGTGCCATTGATCTCTCTTTCTGATGCTTCTACTAAAAATTTGGTCCACAGTGCCATGAGTGTAAAATTGTGGGATCTGAAGTGCCAAGTGACAAA
TTTATCTTTAGTGTCACTGTGAACTTTGGTTGGAGTTTCCACCTGCAATGTTTTATATGGTTTGTGTTAGTTTCTGAATTTCATAACGGCAGGAGATAAAGTTTCCTACAAATGTAAGGT
AAACAGAGTAGAATTCATTCGATATTTCTTTAGGAAGAAATCATCAGAAACAGATAGTCGATCATAAATTTTCTGCATCATGAAGGTAAGGTAGCTTATCTTGCCCACACTAAATTCATG
ACACCATGGGAGTTAATGTCATGTGATTCTACGTTATCACATACACATATACAAAATCAGGCATTGATCCACTTTGGCCTATCTTTAGCATCTAGATCACTCGACCATTTGAACGAGGAC
ATGAGGCTATGCAAAGATATGTAGATGTTAGGATTTCCCAATCGATATGATGGAATTGAATATTCATCCAAATGGCTTTCTTGTGCTCATTTCCTTATCTTTTCCTAGAATAACTGAAGA
AGGGAGACAAGAAATTTGTAGCAAACCACGAAACAAACTGGGAAATTTTTTATTGCCGTTCTCACTGATAATCTTGTCCAAGAACACTGGTGAAAAGGGTGTATTGCTACATGCTATTAA
CATCTTGCGGAGCTAAAACAACGGTTACCCACCTGAGACAGTAAACAAAGTAGTGACTCCATCTGGTTCCGTCCAATTGAATCTGCAGCGAACGCCAGTGTCTTCCCTTGGACAATATTC
AAGAACAGCTGGGGCTCAAACCTTACCATGTCACAACCATGTGGCATCCATTTCCAGTTTACATAATCCATTTGCTTTCCATACTTTGCACAGTTTTTTGAGTCTGGCATCGTTGGGCAT
GTTATGTTAGTGTAAATCGGGCCTGTGAAATCCCTGACCCATGTGCCATTGAACAGATTACAGACCTTGTCTTGATGACCTGAAAGGAAGAACAAAATTACCCCTTATACAAAATTCTTG
GACAAAGACGCTGCTTGTGAAATTGCAGGGAAATGTTAGCTGTTACCAACCTAGTATATTTGAAAAATGAAAAGTGTTATGACTCACTGGTCGAATTTCGGAGGCAAAGAGATCTATTTT
TCTTTGTTTATTCATGTTTTTACCTGTGTTTTTATAAGGTCTTGAACTCTTGATTATTTTTTGCACATGTCCCATTATCATCAACTAATCTGACATGCAGAACATTGCAAGGTCTAAATG
CCTCTCAATTATTATATACGGATTATCTGAAAACTAAAGAAGCCATTTGAATATAGATAACCAGGCTTCATATGCTTTTGAAATCACAGGCATGCTGAACATACTATCTAATCTTTGATA
AGTCAGATTTTAACTCGATGTACAACATTGAGCTGGGATCTTATGCTGCAGCTATACCATATTTGAAATGAACAAAGATCCAGTAAATTTCAGGAAACGAAAGGGGCACTTGGAACTCTA
CAAGTACTCGAAATCTGTCCAGAATGTAACATTTCAGGCAATTTTGCATCAAGAAGAAAGAGCAGATAAATGTATGCTAGTCAGTAGAGGAGCACCTATTTTCGTCTCCTGAGGAGAGAT
GTGAGTTGCCATAGGAGAGTGGTAGAGAGCCGCAGGATGATATGTTGAGAGAAGAAAGACGAATAGACCTGTGGTGAGCATCAGCGCTAGTGTTTTTCTTCCACCAGGAAATACATGGGT
AGGTGTTCTGACGTTGTTTCGGCCATGGGGATTTGGTGGAGGTGCGGTTTCCTTGTTCATGGCCATGGTCAAGGACGAAGGTTCTACGCCTCTAAGTTGCGTCATGGTTAAGAAGTCACC
ATTGTTATGGGTACTAAGCTTGCTGCGAGCAATTAATGAACCTAGACAAATGTGCATTTCTCCATTTATTTTCTTAGTTCGTGGTAAAGAATTCAATCTTGCTGGGGCTGTGAGCCATTG
ATGCCCCTGGAGAGCAGTGTCTGCATAGACAAATGTGTATTTCTTCCCTAATTTCTTTGTTCAAGGCAGCGAGGTGCTTACAGCAACTTCAATGGTTCTGGTAGTAAACCGTGGATCACT
AGGAATCATCANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTAATCAAAGTACTCCTAGATAATACTACTTTTTATACTAGTAG
TATACCTTGATGTTTTTTCAATCTAGGAGAGTGGGAGCATCTGAATTCTCTCAGCACAGTGAAATCAAAGTGCTGGCTCAGTATGAGTTTCAGTGTTTCACTTTTGAAAGGTCAAACTGA
GAGTACTCAGTGCTTGCGCTAGTTGCTTTCATCAAACCGTGATCAGCTCTAGGTTCTGTTTTTCCTTCTGTGACTAGCACTATGTTCCGTTTTTTGTTCAGTGCTTGCACTAGTTGGATG
CTGGAACCCGACCAGATGCCCTTGTTTGACTTTGACAACATCTGTTCAAACTCATATATGATTTCTTGATTGTTGCAATACTATGTGAAATTCCGCTAGACAAACTTGCCCTGTTTCTGT
CCCATACGTATCCAAATGTTTCACACGGATGACAGATGGAACCTATGACTGCGCACGGGCGTATGGACTATGGCCTCGTCTGAACAATAATTCCAAGCGTGGCCTCGACCTCGATGACAG
TTGACTATCTTGTAGGATGCAGATGCAGACCGGCACATCACTGGCACCGGCACACCGTAGCTTTACGTGCGGCGTGGAGGCTAAGCAACATTCCAGCTTCCGGCTAGGTGGTGTATACGT
GAGTAGACCANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAGGTGTGTCGTAGTGTCCATGAGCCGTTAAATCACTTCCCAGCCTTTTGACTGCAGCTTTGGATGGCTTGCTTCAGAGATTTCAAA
ATATGGATCCGAATTCGCAGTTCTCATAAAATTTTGACACCAAAGATGCAATTTTTTCCGTTTAGGGTGTTTTTCCTCCATTTTCTTTTGAAGGAACATTTTCCCTCCTCTTCCCCATTT
TCTCCTTCTCTCTTTTTATTTTTTTCCCGTCTCACTGGAATGGACCAAACTGCTCCTGCCCTCTTTTTCGTAGTCTGGACTCTGGATTGGNNNNNNNNNNNNNNNNNNNNNNNGTAATCT
GGATTGGATTGAGTCGTCCTCTCTCGGTCTTGCGCCGCCACAACCGGTTTCGTGGTTGGGGCAAGCCCAATATATCTCTTTAGACAATATGGGCCCATCATAGCAGCGGGCAGGGCCCGC
CAATCCTATCGGGCTTCCGAAAGCCAATATCTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCATTTTGTAAAAATATATAGTCACACGCCGTTTGAAACGGTTTAGCCGGCGGAATCTC
CGACCACTCGACACTACACTTCCAAAAAATCATAATTAGTTCATATCAACTTGGATGGAGATAAGCGTTATATGAAAATTGTAGAGCTCGACGAGATCTACAACTTTGTAGTTGAAACTT
TTTTCATTTGATGTCATATCGGTGCTCAAATAATCGACACAAGTTTCAGATCTAAAATTCGAATTTTAGATCTAAAACTAGGCAACACGCTTTAAAAAATAATAACTAATTCATATGAGC
TCAGATAGAGATAAGTTTTATATAAAAATTGTAGCTCTCGATGAGATTTACAACTTTGTAGTTCCGTTTTTATTTGGAGCTATTTAATTGCTCAAATAATCGATACAAGTTTTAGANNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGACTACAAAGTTGTAAATCTCGTCGAAGGCTACAATTTTTATATAAAACTTATCTCTATCTGAGCTCATATGAATTAGT
TATCATTTTTTTGAAAGCGTGCTGCCTAGTTTCAGATTTAAAATTCAATTTTGATCTGAAACTTGTGTCGATTATTTGAGCACCAATATGACATTAAATGAAAAAAGTTTCAACTATAAA
GTTGTAGATCTCGTCGAGATCTACAATTTTCATATAACGTTTATCTCCATCCAAGTTGATATGAATTAGCTATGATTTTTTGGAAGTGTAGTGTCGAGTAGTGGGAGATTCCGCCAGTTG
AAACGGCGGCAAGGATACTACAGTACCCATTCCGGCATTTCATCTGACTATAGCCGTTTCAAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNCCAATATCTTATATAGCTTCCGGTGATTTAAGATATGTTATAGGGCCGCACGAATCTCTTCCTCTTCCTCCACCTCTCTCTCGCTCACTCACGCCG
TCTCATGCGCCGCCGCTGCTTGCGAGCTGGAGGGGTGGGTGGTGGGGGGAGTGGCCGACGACGACCTCGCGCGCCGGCCTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNCTCCAATGGCCAGCGGCCATAGAAGAGGAGGATGTCGGGGGCGGCACGGAGGCCCGGCGGTGGTGGCGGGTTGGCTGGCAGCGGCGCTCTAGGTGAGGCTGG
ATGGCTGGTGGGCCGGTGACCGGCAACGGGGGCAAGAAGAAGGTCGGGGCCGAAGGTCGGCGGTGGGCGGATGGCGTTATGGCGAGCTAGCCGCCGACCGGGGCGGAGGACGAGGTGGTG
GAGGTGGTGGTGCGCTGGGGAAGAAGTCGGAGAGGAGGTGAAGAAGAGAAGGAGATGGGCCTGATGAGCCGGAAGCCAGGTACCTTCCAGCTTCCGTGCGGGACCCCCGGCAGGGCCAGA
CAAAACTCGGAAAATCCGTCCCATCTCGCGCGCGCGTCCGCCGTCCGCGCGAGCCCCCTCCTGCCGCCGTCGTATACAGCGGCGCATACACACACAACAGGCGCGCCTGACACTGAGGCT
CCTGTCGTGAATTGGCTCAGCTGCATTCCGCTATGGCTTCAGGAAGCAGCAGCCAATGATCGTAACCTGCAGCGTTTTGATTATGAAAGCTCTCTAATCTCAAAAAAAAAACAGGCGCGC
CTGACACTGGGCCCGTCTCCGGCCTCTAAAAGATTCCCTCTTTCCACGAGGCCATTGGGACCGGCTCTTTGTCATGAGCTGTCCTCTGGGCTGTGGGTCACCCGCCGCTCGCGCCTGCGC
TGCTGCTGCTCCGGACCTGCTCCTACAGAGCCTAGCGACGCGTGACGCCGCAAGGGCCGAGACCCCAGCATGTGTTGGTGCCTTGGAGGCATCTCGTACTACAACTACTGGCACAAGCAT
GCACGGGCTGACGGGCAGCTCGCCCACAAGACAGGAAGCAGCAGGCCGGGCGGGCGGGGCAGTGCATCATCGCGCGCCCGCGCATGCTCCCACCCGGCCACCCCTCGCCCTGGGTGGAGT
GCAGCTCAGCCTCGCATGCGCAAGCCCCACCCACCCTCACGGAGTCACGGCCTCGCGCTAGCCTGACCGGCCTGACGCCGGGCCGTGCACCGTGCGTGCGCAAGGCCACTGAGCGGTGCA
CAGCAGCGAACCGTGCAGCTGGTACAGTAGCATTTACGATCCTCCGCCTTGGAAGAAACATCTTTTTTATCATCGTCAAGTAAAGACTAAAGCGCCGTTTGGTTACAGGGCCAAAATTTA
CTCACTATCACATCGAATGTTTAGATACTAATGGTTACAGGATCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTATCTTGGGGGGCGCCGCA
GCGTATTTACAGAAGGGGCGCTCTGCGGCGCCCGCTCGGCTCAAAACAACGGAACAGCCTGACAGCCATGGCGGAAAATGGCTCACGAGTCACGACTCCAAGAAAACGCCATGGTTCACA
CTTCACAGCTTGGCGGTCCAACACGCCGTTGTTCGTTTTTCTACGGTAAACACAGCATTTGCGTGGAACCTTTTGCCCTTTCCTCGTTAGCCTGCCGGCACTCGAAGTCTCCAAGCAAAT
GTTGGATAAATACGAGGCGATTTTGAGCCGTCTGTCTTTCTACTCTCTCAGGGAAAGGCAAATGTTGTGGCGCCCCGTGATGGCGGCAAGGCAAAGCCCATTTACCTGCTGTATTAACTG
ACGCCGGTAGTACGTGTCAAGGCGATTGGATGAGGCAGAGGCACCGCAGAGGCAGGCCGGCCACCTGCGCCCTCCGCTGGGCGCCAACCTGGCGCATTGACCCGGGACCGTGGTCACACA
CCCTGACGCGCCACGTCAGTACGTCACGGCATCATCACCTCCACAGCAGCTGCAGGCCAGCACACTCCCAGCTTGCCTTTACTCCGTGTCTATTAACCATCACTACTGACCAGCCCCGCC
AGGCCGCCACACAAGAAACGACGGAGCGGGAAGACTCTCCACAGCTCTCAATAAAGCTCTTCCAGTCCAGTCTCCGGCCGGCATCGATGGCGCCCGGCAAGCTCGCAGCGGCCGTCGCCC
TGGTGGCAACTCTCCTCCTGCTCAGCAACAGCAACATCAAGGTAACCAAATAGAGCAGCTGCCACTTGATTCAGAGAGCTCACGGATGCATCCGTGCAAAGTGACTAGCGCGTTCTTGCT
CTCTCGCCTGGTTCTGCTCTGAACTCGCTCTCTGGGTGTTTTTGGCCAGGCTGCTCCGGGCGGCTATCCGCCGGCTCCTCCCGTCGGTCCTCCGCCGCACCAGATCGTCGACCCCGCCAA
AGGTACGCGCCGCCGACGCACAGACCTCTCTGTTCACGACGATGCTTGGCGTCGCCGCTTAACGCCTGCAACATTTTTCTTGGGCGCAGACTGCGGGGGCGCCTGCGACGTGCGGTGCGG
CGCGCACTCGCGCAAGAACCGGTGCACCCGGGCGTGCCTCAAGTGCTGCAGCGTCTGTCGCTGCGTGCCGGCGGGCACGGCCGGCAACCAGGAGACCTGCGGCAAGTGCTACACGGACTG
GACCACGCACGGCAACAGGACGAAATGCCCGTGAGCGTCTGCGCGGTGGGTGTGGCCGGTGAGAGCGTGCTCCCCGGCCGAAAGCACCATGTGTTTGTTTGTACTATGATCCATCGGCTT
AGTTGTAGCTAGCTCGTGGTTGCTGTGCTCTGCTGTTTCTTTGTTGGGTTCTTTCTTTCGTTGGTGGTCTCTGCGTTCCCGTGTAAAAAAAGAGTGAGGCGTTTTCTCTAGATGTAAAAT
CCCTCTGGGTTGGATTGGATCAATGCAACATCTTTATATTTGCACGCTAGTTTTACCCGTGCCTGTCTTAGGCGTAAAGCGTTTTACCCGTGCCTGTCCTAGGCGTACCCCAATAAAATT
TAAAGTTTAGTGCTATGTCACATTATTTGATCCTAATTAGGAGTATTAAATAATTAGGAGTATTAAATATAGGGTAATTATAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNACAAACAACCCAACCCATTAGTTTTGTATGCTAGTT
TATCGTGATAATTAATTTTCTTTGCAACATTTTTACTTTTTACAACGTTGAATCTTTTTCTAACTCCAATAGTACCTGATCCTTGTAAAAGCTTCGTCTGTTAGCATTGTTGGTTCGTCT
TATGATGATCAGAAAAGAACATGCTACACGATACATGTGACTTTGCTACCTGTTTCAGCTCCAAAACGGTGTAAAAATCCAGTTGTCCTAGCAGTAAAACCCTGTTGCCGCATGCTCTGA
CACTCCACCATCATGTACGGCAAGCACAGCAGGGTTACTAGAACGATCACAATAGTTTATCGCCGACCAACTGCTGCAAAACGTATATGCCATGCTGTCAAGTAAGATTAGGAGAAGCTT
AGCGGATAGAATCTTAGAAGCAACATGCAAGAAGAAAGTGGTGAACAACTCCTGCAAAGGCATGTGCCAAGGTGTCGACTCCATCCGCTTTACCTTCACTGTAGCGGTGCAGACTGTGTC
GCACGCGCCCTGTCGTGTTGCTCGAGCCGCACATATANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATGGCTCGGGTAACACCGTTAGCTACATGTGTTTAGTGGGACCCACATGTCATATAT
GGGCCCACATGTCATCTTCTTTTCTTTTTTTTTTCTCCTCATCCTTATCTTCTCCAACCCGCTAGAGCTCCCGAAGGCCCAGGCTGCACGGCCCCTGCTCGCCCGCCGGAGCTCCGNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGAGGTACC
CGCTCGCCCCAGGATGCGCCGCCGGAGGGGCCTGCTGGCCGTGGGCACCGGCCGCGGCGCCGGGGTGCTCGCCCCGCCGGCTGGACCCGCTTGCTCCGGCGGCCGCTCGTCCCAGGCCAC
GCCGTCGGAGGTCCCTGCCGGCCGCCGACCCTGGGCACCGGCCGCGCCACTGGAGGACCCCGTCCTGCCGGAGACGAAGCAGCCCCGCGCCAGTCTTGCGAACGGAGAAGGACGGAGCAG
ACGGCGCCCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NATCAAATTTGGGANNNNNNNNNNNNNNNNNNNNNNNNNNNCGGTACCAAACACACCCATAGTGTCTGTCCATGAGACCATGGCTCCATGGCCAAGGCTGGTCACGCACGCCTGGATAGC
AGGTGCAGCGCCACCAACCACCACCAAGCTTTGTCACTGCCGTGCATGCGCCCGTACCGCGTGGAGACCCACTGGAGGTCAGGAACCTTAGCGGCCTAAAATCCAGCAGCAAGGAAATCA
CGACGACATGAAAGACTGACATTCAGGGTTAGGCCCTCTTTTGTTTGTGGATCGCAAGTTGTTATATGAAACAGGCAAGCATCTAACAATCTGTTTTCCCAATTTGTAGACTGCAATCCA
TAATCTGCAAAGCTAAAACAAACCCATTAGCTCTGCGTTTGAAAGTCCCGTCTGGTTCGTCCGACTACACGAGTGAACATTCGAGTCGGTCATGCCCACGAGCCCGCCCGATGCGGCACT
CCAAAGACCTCCAAAGTCCCGGCCTATCCAACAACCGAGTTCCTAATATCAGCCCACGAGCCCGTTGCGGCACTCCCAGGACGGTCCAGCAACGGGCAAACTGCCCGCATCGGGCCGCTG
CCCAAAACGACGACGCGGAACGGCCCTCTCTCTCGTCGTCACGCGCGCGCGAGGGGCCAGGAGGAATCTCGTCCGGCAACCCCAGCCCAGCCCAGAAACACGAGCCAGCAGGCGGCCAGG
CCAGGTGCTCGTCAATTTTATTAGTTTGCCGTGACAAAGTTTATGCAGTTTTTTAAAAAAAATTAAGTTTATGCAGATTTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATCACCGCTGTATTCTCAGCATGTGCGGTGTACGTATGCACGGG
GTCGGGTCAGCTTCAGCTGGTCCCCTGACCAATTCATTTCCCGTTCGGCCGCGTCCTGTCCTCGGGATATAACTGTGGTCGCTCGGCACCTCTTGTCATGAGCCATCAGCCATCACCTGT
GTATGCGTAGGCCTATCCTGCCTGTGGATGTGCGCGCCTCGCACCAGCTACGTCGTCGTCGTGAGCTGTATCCTGTTCGCGCATCACCTGCTGGCGGCGTCCCCAGCTGTCCGAGGACCG
CGACCGTTGCGGCCCTGATCCCCTCCCCTCCTCCTCCGTGCATTGTCGTCGATATCCCGCAGATTTGGCATCTCGACGGTCACGCCGCGCGTGCATGTGAACCCTGAAGCGTGCGCCAAA
AGGATTGGATTTCCAGAGTCCAGACTCCAACGCAGACGACGCGCTGTCCTCTCCTCTTGTGGGTTGCCATGCCTAGCGCGGCAGGCTAGGGCTCTATGCCTCTATCTCAACGGTATTGGA
AACCCAGCTGTACGCTACCGGCTACCAGGAACGGACGGAGTGGACGACATGGTGGAGAATGCGTGCGCGCCGGGGCTCGCTGTGGCTGGGCTATCCAACGCGTAGTGCGCTCGCTGCTGT
AGGTTGTAGCGTCCTGCCGCTGGCGCCGCGTGTCTCGCCGGATGCGGCATGGCGGCCGTCCGATGGTTCCCGGCCGCGTGCATTTCCCACCGCCCGGCCACTGGGCTACACTGCTGAACT
ACTTTCTTCTTTCTTGCTGCAAATGTTGCAAACCAAATTAAGGTAACTAGCTCCTCCTCGCTTGGTGTGACACTAGAGTAGTAACCACAGTCAACAACCTATGCGCAGGTATCGTAACGG
CGAAGTGAAGTACTCGCTGACTGAGATGGCTGCTTTGGACGGGAGCTCCGGAGATGAAAACCTCCACGCCATGATCCTAGCTTTCAGTTTGGCGTGCTTTCCGCGTGGGCACGTTCAGCA
GGGGCGTCTCTGGGCTCTGGCGCGGTGCACCGTGCCGTGCACCCCGGCTCGGATGCCCATGGAGCCCGGGCAAAAAAATGTAGCGGGATGCGTGGCCACAGGACACGGTTGCGTCGGTTG
GTGCGTCTCCGCTTTATTGCCGCCACGGTCCCCATGGTCCTCTCGGCGATTCACCACTAGCCAAAAAGTGAGCCCGTTGGGGAATTTGTTCTGCACTACGGAAAAAGGCCGCTACTGATG
CTACCCTGTCGATGCCAATGAGCTGTTGCCGCCGCAAATACTTCAGGGTAAACTTTGGGTAAACCTCGACACGGCACTAGGAGAGCACTTGTCTTCAGGGTTCAGGCCTGCATTGTCCAT
CATCTTTGGGGACGGCGCGCTGATGCTCAGATGGGATACGATCCCAGGCGCGGATTTGTTTTTAACGTGGATCACTGTGCCAAACAACATAATCTAGGACAGTATCTACCGCCGCGCTGG
AGAAAACAAAGGTGAAAACCCAAAACATCCGTCCGTCATCGGTCGTCCTGCTCCTGCCGCCTCGAGCTAACAAACCACCGCGTTCCGCCTCCGCACCGCACTCTCCTCCGTCCTCCCCCC
TTAAACCCCGCAATCAATTCGCTCGCCACTACACACGCCGACCCTCACTAATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNAAATCGAGCCAAGAGCGCCGCCATCGCCGCCGCATTTACTCTTTGACTATTCCTCTCCCTAGCTTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCGCGCGCGTGGAGCGGATCGTG
TCCGACGTCATCGCCGCCAAGCAGCGCGCCAACCCGTCCACGGCGGCGGGCACGCTGCGCCTCTTCTTCCACGACTGCTTCGTCAACGGCTGCGACGCGTCCGTGCTCGTCTCCCCGCTC
TCCTCCGACGCGTCCCCGGAGCGCGCCGCCGAGATCAACCTCTCCCTCCCGGGGGACGCCTTCGACGCCGTGGACCGCGCCAAGGCGGCGCTCGAGGCCGCCTGCCCCGGCGTCGTCTCC
TGCGCCGACATCCTCGCCCTCGCGGCGCGGGACCTGGTGGGCATCCTCGGCGGGCCCCGGTTCCCCGTCGCGCTGGGCCGGCGCGACGCCCGCCGCTCCGACGCCCGTGACGTCGAGGGG
AACCTGCCCCGCACCAACATGTCGGCGCGCGCCATGGCGCGGCTCTTCGCCAGCAAGGGCATCACGCCCCGGGAGATGGTGGCGCTGGCCGGCGCCCACACCGTGGGCTTCTCCCACTGC
GGCGAGTTCGCGCACCGCATCTACGGATACCGCGGCGCCGGCGGCCACGACCCGCGCCTGAACCCGGAGTTCGCCCTCGCGCTGCAGCGCTCCTGCGCCGGGTACCGGAGCGACCCCACC
GTCTCCATCTTCAACGACATCGTCACGCCCAGGGACTTCGACGAGGCATACTACAAGAACCTGCCCCGCGGGCTGGGCCTGCTCGCCTCCGACGCCGCGCTCTGGGAGTACCCGCCCACC
AGGGTCTTCGCCGAGCGCTACGCCGGCAACCGCACCGCCTTCTTCGAGGACTTCGCCGCCGCGATGCAGAGGCTCGGCGCCGTCGGCGTCAAGACTGGCCGCCAGGGCGTCGTCAGGCGC
CGCTGCGACGCGCTCGACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CGTCTTCTACTTCCATTTCTCCTCCTAGCCGCGGCGGCGGCAGCCTCATGCGCCGCCGCTGCTCGCGTGGAGCGGATCGTGTCCGACGTCATCGCCGCCAAGCAGCGCGCCAACCCGTCC
ACGGCGGCGGGCACGCTGCGCCTCTTCTTCCACGACTGCTTCGTCAACGGCTGCGACGCGTCCGTGCTCGTCTCCCCGCTCTCCTCCGACGCGTCCCCGGAGCGCGCCGCCGAGATCAAC
CTCTCCCTCCCGGGGGACGCCTTCGACGCCGTGGACCGCGCCAAGGCGGCGCTCGAGGCCGCCTGCCCCGGCGTCGTCTCCTGCGCCGACATCCTCGCCCTCGCGGCGCGGGACCTGGTG
GGCATCCTCGGCGGGCCCCGGTTCCCCGTCGCGCTGGGCCGGCGCGACGCCCGCCGCTCCGACGCCCGTGACGTCGAGGGGAACCTGCCCCGCACCAACATGTCGGCGCGCGCCATGGCG
CGGCTCTTCGCCAGCAAGGGCATCACGCCCCGGGAGATGGTGGCGCTGGCCGGCGCCCACACCGTGGGCTTCTCCCACTGCGGCGAGTTCGCGCACCGCATCTACGGATACCGCGGCGCC
GGCGGCCACGACCCGCGCCTGAACCCGGAGTTCGCCCTCGCGCTGCAGCGCTCCTGCGCCGGGTACCGGAGCGACCCCACCGTCTCCATCTTCAACGACATCGTCACGCCCAGGGACTTC
GACGAGGCATACTACAAGAACCTGCCCCGCGGGCTGGGCCTGCTCGCCTCCGACGCCGCGCTCTGGGAGTACCCGCCCACCAGGGTCTTCGCCGAGCGCTACGCCGGCAACCGCACCGCC
TTCTTCGAGGACTTCGCCGCCGCGATGCAGAGGCTCGGCGCCGTCGGCGTCAAGACTGGCCGCCAGGGCGTCGTCAGGCGCCGCTGCGACGCGCTCGACTGA

Retrieve as FASTA