Entry information : SiPrx61 (Si012779m)
Entry ID 9556
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiPrx61 (Si012779m)
Name (synonym) SiPrx61 (Si012779m)
Class Class III peroxidase    [Orthogroup: Prx010]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx61
start..stop
S start..stop
SbPrx86 613 0 1..317 1..317
OsPrx136 594 0 1..317 1..317
OsPrx131 594 0 1..317 1..317
OsPrx57 472 1e-169 3..317 4..319
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 35573465..35573674 210 N° 2 35573194..35573385 192 N° 3 35572703..35572868 166 N° 4 35572191..35572573 383
complement(join(35572191..35572573,35572703..35572868,35573194..35573385,3557346 5..35573674))


exon

Literature and cross-references SiPrx61 (Si012779m)
DNA ref. Phytozome 12:   scaffold_7 (35573674..35572191)
Protein sequence: SiPrx61 (Si012779m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   318 (294)
PWM (Da):   %s   33954.83 (31491.6) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.14 (7.98) Peptide Signal:   %s   cut: 24 range:24-317
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASHKPLACSVLAFFFAASLVSAQLTANFYDKSCPNALYTIQTAVKSAVAKENRMGASLLRLHFHDCFVNGCDGSVLLDDTPTFTGEKTAVPNNNSIRGFDVIDSIKAQIEGICPQVVSCADILAVAARDSVVTLGGPTWVVNLGRRDSTTASLDAANNDIPKPTFDLSDLTKSFSNKGLTATDMIALSGGHTIGQARCVNFRNRIYSEANIDTSLATSLKSNCPNKTGDNNISPLDASTPYVFDNFYYKNLLNKKGVLHSDQQLFNGGSADSQTTTYSSNMAKFFTDFSAAMVKMGNISPLTGSSGQIRKNCRKVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTCATAAACCCCTCGCTTGCAGTGTCTTGGCCTTCTTCTTTGCTGCAAGCTTGGTTTCAGCTCAGCTTACTGCAAATTTCTATGACAAGTCATGCCCAAATGCACTGTACACC
ATCCAAACAGCCGTAAAGTCTGCTGTGGCAAAGGAGAACCGCATGGGTGCATCGTTGCTCCGCCTCCACTTCCATGACTGCTTTGTCAAT
GCAAGTCTCACCAAATCTGCAGATATGTTA
CATACTTTACATTTTCTGGATTATTGACATGGAAATCCTAACTATACAGGGTTGTGATGGCTCAGTGCTGCTTGATGACACCCCAACCTTCACAGGGGAGAAGACTGCTGTTCCGAACAA
CAACTCCATACGTGGATTTGATGTGATTGACAGCATCAAAGCACAGATTGAGGGTATCTGTCCGCAGGTGGTATCATGCGCTGACATCCTCGCTGTTGCAGCTCGTGATTCCGTTGTTAC
G
GTAAGACAAAAAAAAAGAATATTTAAAATTAGTTTAACAAATTAACTATTGAAGTGTTTATGACTCTGACCGACACGCGGCAAACCACAAAGGTAGTGCGTGTCCAATATTTTAACTGA
AATGATGATGGGAAAACTCTTTATGTTTAAGAGGCTATGATAAATTGATAAACCTTGACTTAAACAAAGCATCAGGAAGCAGTAAACTAAACTATTAGAGTCAATACTCAGATATTCAGA
GATGTTATCGCAACTGATTGACTAAGCATGTTTCACGCATTCCAATAGAAACAAACAATAGTAAAAGTTGACAATTTCTACTTCAGCTTGGAGGGCCAACTTGGGTTGTCAATCTGGGAA
GGAGGGACTCAACGACAGCAAGCCTAGATGCTGCAAACAATGATATTCCAAAGCCAACCTTTGACCTCAGTGATCTTACCAAGTCCTTCTCAAACAAAGGACTGACTGCAACTGACATGA
TTGCACTCTCAG
GTACTGAAAGATTGCAAATTTTGTCATCAACCATATAAGTGGTTCATAAAAAAGTAGTCAAAAGCTAGATGTTGAAAGCGAATAGTAGTACTGCTAAATACTGACTGA
CACAAAACGAAAAATTGCCAGGAGGCCACACCATTGGGCAAGCCAGATGTGTCAACTTCCGCAACCGCATTTACAGCGAAGCTAACATTGACACATCCCTTGCAACATCACTGAAGTCAA
ATTGTCCAAACAAGACTGGTGACAATAACATCTCCCCCCTTGACGCCTCAACACCCTATGTTTTTGACAATTTCTACTACAAGAACTTGCTGAACAAGAAGGGCGTTCTGCATTCTGACC
AGCAATTGTTCAATGGAGGCTCAGCAGACTCCCAGACTACCACCTATTCATCAAACATGGCAAAATTCTTCACCGATTTCAGTGCAGCGATGGTGAAGATGGGCAACATTAGTCCGCTCA
CTGGATCAAGTGGACAGATAAGGAAAAACTGCAGGAAGGTAAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTCATAAACCCCTCGCTTGCAGTGTCTTGGCCTTCTTCTTTGCTGCAAGCTTGGTTTCAGCTCAGCTTACTGCAAATTTCTATGACAAGTCATGCCCAAATGCACTGTACACC
ATCCAAACAGCCGTAAAGTCTGCTGTGGCAAAGGAGAACCGCATGGGTGCATCGTTGCTCCGCCTCCACTTCCATGACTGCTTTGTCAAT
GGTTGTGATGGCTCAGTGCTGCTTGATGAC
ACCCCAACCTTCACAGGGGAGAAGACTGCTGTTCCGAACAACAACTCCATACGTGGATTTGATGTGATTGACAGCATCAAAGCACAGATTGAGGGTATCTGTCCGCAGGTGGTATCATGC
GCTGACATCCTCGCTGTTGCAGCTCGTGATTCCGTTGTTACG
CTTGGAGGGCCAACTTGGGTTGTCAATCTGGGAAGGAGGGACTCAACGACAGCAAGCCTAGATGCTGCAAACAATGAT
ATTCCAAAGCCAACCTTTGACCTCAGTGATCTTACCAAGTCCTTCTCAAACAAAGGACTGACTGCAACTGACATGATTGCACTCTCAG
GAGGCCACACCATTGGGCAAGCCAGATGTGTC
AACTTCCGCAACCGCATTTACAGCGAAGCTAACATTGACACATCCCTTGCAACATCACTGAAGTCAAATTGTCCAAACAAGACTGGTGACAATAACATCTCCCCCCTTGACGCCTCAACA
CCCTATGTTTTTGACAATTTCTACTACAAGAACTTGCTGAACAAGAAGGGCGTTCTGCATTCTGACCAGCAATTGTTCAATGGAGGCTCAGCAGACTCCCAGACTACCACCTATTCATCA
AACATGGCAAAATTCTTCACCGATTTCAGTGCAGCGATGGTGAAGATGGGCAACATTAGTCCGCTCACTGGATCAAGTGGACAGATAAGGAAAAACTGCAGGAAGGTAAAC

Retrieve as FASTA