Entry information : SiPrx71 (Si017675m)
Entry ID 9562
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiPrx71 (Si017675m)
Name (synonym) SiPrx71 (Si017675m)
Class Class III peroxidase    [Orthogroup: Prx147]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx71
start..stop
S start..stop
SbPrx70 553 0 28..343 35..350
ZmPrx27 532 0 17..343 11..340
TaPrx129-1A 469 1.5e-167 18..344 6..327
TaPrx129-1D 465 6.64e-166 35..344 40..344
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '9562' 'join(7137717..7137959,7138061..7138252,7138340..7138502,7140370..7140812)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 7137717..7137959 241 N° 2 7138061..7138252 190 N° 3 7138340..7138502 161 N° 4 7140370..7140812 441
join(7137717..7137959,7138061..7138252,7138340..7138502,7140370..7140812)


exon

Literature and cross-references SiPrx71 (Si017675m)
DNA ref. Phytozome 12:   scaffold_1 (7137717..7140812)
Protein sequence: SiPrx71 (Si017675m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   347 (316)
PWM (Da):   %s   36756.53 (33463.9)  
PI (pH):   %s   7.96 (7.17) Peptide Signal:   %s   cut: 32 range:32-347
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATSRPLSSSSWRRSAMAMAMVVVLAGSVTGARGQLRMGFYDKSCPGVERLVGAFVRQHVDRVPTVAAALLRLHFHDCFVRGCDASVLLNSTAGGVAEKDAPPNLTLRGFDFVDRVKALV
EEACPGVVSCADVLALAARDAVAAIGGPSWRVPTGRRDGTVSSMQEALDEIPKPSMSFKQLTDLFATKGLGVRDLVWLSGAHTIGIAHCSSFADRLYGHPGAGAGNDTTDPTLDAAYAAN
LRRRKCRAPSGGFAEDAVVEMDPGSHLTFDLGYYRALRKHRCLLQSDAALLTDPAARADVESVAGGPDEVFFQLFARSMATLGTVQVKTGAEGEIRRNCAVVNSPSN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGACGAGCAGGCCGTTAAGCAGCTCGAGCTGGAGGAGGAGTGCCATGGCCATGGCAATGGTGGTCGTGCTTGCCGGCAGCGTGACCGGCGCGCGCGGGCAGCTCAGGATGGGGTTC
TACGACAAGAGCTGCCCGGGGGTGGAGCGGCTGGTCGGCGCTTTCGTCCGGCAGCACGTCGACCGCGTGCCCACCGTCGCCGCCGCGCTGCTCCGGCTGCACTTCCACGACTGCTTCGTC
AGG
GGGTACGCGCTTTCGCAGCCGTGCATTACGTTTTGCCGCCGCCGCCGTGCCAGCGCACGCACGCACTGACCGCCGCCGTGGGTGCGTCCGTGATGTGTTCCAGGGCTGCGACGCGTC
CGTGCTGCTCAACTCGACCGCCGGCGGCGTGGCGGAGAAGGACGCGCCGCCGAACCTGACGCTGCGCGGCTTCGACTTCGTCGACCGCGTCAAGGCCCTCGTCGAGGAGGCGTGCCCCGG
CGTCGTCTCCTGCGCCGACGTCCTCGCGCTCGCCGCCCGGGACGCGGTCGCCGCCATT
TTGTGCGTGAGCTCATCGTATCATCGTGCTCTCTGCTCCGATCCCTTGCCAGCTGAAAACTT
GAGCTGACGGTTTGTCAATCGTTGCAGGGCGGGCCGTCGTGGCGCGTGCCGACGGGGAGGAGGGACGGCACGGTGTCGAGCATGCAGGAGGCGCTCGACGAGATCCCCAAGCCGTCCATG
AGCTTCAAGCAGCTCACCGACCTGTTCGCCACCAAAGGCCTTGGCGTCCGTGATCTCGTGTGGCTCTCAG
AGGTACACCCTACCTGACTGATCAAGTGATCATCATTCATCACAGGACAG
TTGTGCACACANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNATCAGGCTTTGTTCAGAAACAAGAATTTCACTAATGTTAACTGTTAAGTTCTACAAGAAAAAAAAGAAGAAGAATAAAATCGGTTTGATTTCAGAGAGGCATAAGAAGAATAGG
CCAGGCACTCTGAGGAGATGGTCTGGCTGTGATTGCCCATTCTTTGTGTGCTGAGTGGGCAACAGTAGCACACGCAAAAGGAGCACAAATAATGGTTCCTTTCGCTGCCTATCTTAAAGC
GGATCACCAGATTCCTTGAAGGAAATAATCCAAATTTACTTTCAGCTCCGACTCACTTATGCTTACCAGCTTCCTGTCCTCTCCTATGCCTCTATGGCTAGCTTGAGATGATAGCTGAGC
ACTGACCATTCATTTATACTGACGTTACTGAATTCTAGCTGTTCCCTGAAAAACAGTGCCTGAATTTTGCGCTCACAGTTTTATAGGTCACTGACTCGCTGCATTTTTAGCTTGTCCGCT
TTGATTTTTTTTCTCCCTCATGTCCTCTCACTACGTCGGAATAGGCTGCCCAAAAGTTTCATCTCATTATGCATATCAGCATGTGTATGGCCTGACATTCGTAGTTGAACACTGACCATT
CTTTATACTGAAATTACTGAATATCAGCTGCTCCTAAATTTTAGTTTTTTTCCTTTATAAAATTGCCTGAATTTTGTTCAGGCAGCTTTATAGATTGTTCTTTCTTTAATTGAACTGCTC
ATGAACAACTTAATCATCAGCTCAAAAAAATGCAGAGACAAGTGCTCTGACCTTTAATGCCGTTCAGATTGTTCCAAGTTTTTATACGCTAACTTCACCGTGTTTTCTTCTGACATGTGG
AATAATCTTGTCTGAACAGGCGCGCACACGATCGGCATCGCCCACTGCTCGTCCTTCGCCGACCGCCTCTACGGCCACCCCGGCGCCGGCGCCGGCAACGACACAACCGACCCGACCCTC
GACGCCGCCTACGCCGCCAACCTCCGCCGGCGCAAGTGCCGGGCGCCGAGCGGCGGGTTCGCCGAGGACGCCGTCGTGGAGATGGACCCGGGCAGCCACCTGACGTTCGACCTGGGCTAC
TACCGCGCGCTGCGCAAGCACAGGTGCCTGCTCCAGTCCGACGCCGCGCTGCTCACCGACCCGGCGGCGCGGGCCGACGTCGAGAGCGTCGCGGGTGGGCCCGACGAGGTGTTCTTCCAG
CTGTTTGCGCGGTCCATGGCGACACTGGGGACGGTTCAGGTCAAGACGGGCGCCGAGGGGGAGATCAGGAGGAACTGCGCCGTCGTCAACTCCCCCTCCAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGACGAGCAGGCCGTTAAGCAGCTCGAGCTGGAGGAGGAGTGCCATGGCCATGGCAATGGTGGTCGTGCTTGCCGGCAGCGTGACCGGCGCGCGCGGGCAGCTCAGGATGGGGTTC
TACGACAAGAGCTGCCCGGGGGTGGAGCGGCTGGTCGGCGCTTTCGTCCGGCAGCACGTCGACCGCGTGCCCACCGTCGCCGCCGCGCTGCTCCGGCTGCACTTCCACGACTGCTTCGTC
AGG
GGCTGCGACGCGTCCGTGCTGCTCAACTCGACCGCCGGCGGCGTGGCGGAGAAGGACGCGCCGCCGAACCTGACGCTGCGCGGCTTCGACTTCGTCGACCGCGTCAAGGCCCTCGTC
GAGGAGGCGTGCCCCGGCGTCGTCTCCTGCGCCGACGTCCTCGCGCTCGCCGCCCGGGACGCGGTCGCCGCCATT
GGCGGGCCGTCGTGGCGCGTGCCGACGGGGAGGAGGGACGGCACG
GTGTCGAGCATGCAGGAGGCGCTCGACGAGATCCCCAAGCCGTCCATGAGCTTCAAGCAGCTCACCGACCTGTTCGCCACCAAAGGCCTTGGCGTCCGTGATCTCGTGTGGCTCTCAG
GC
GCGCACACGATCGGCATCGCCCACTGCTCGTCCTTCGCCGACCGCCTCTACGGCCACCCCGGCGCCGGCGCCGGCAACGACACAACCGACCCGACCCTCGACGCCGCCTACGCCGCCAAC
CTCCGCCGGCGCAAGTGCCGGGCGCCGAGCGGCGGGTTCGCCGAGGACGCCGTCGTGGAGATGGACCCGGGCAGCCACCTGACGTTCGACCTGGGCTACTACCGCGCGCTGCGCAAGCAC
AGGTGCCTGCTCCAGTCCGACGCCGCGCTGCTCACCGACCCGGCGGCGCGGGCCGACGTCGAGAGCGTCGCGGGTGGGCCCGACGAGGTGTTCTTCCAGCTGTTTGCGCGGTCCATGGCG
ACACTGGGGACGGTTCAGGTCAAGACGGGCGCCGAGGGGGAGATCAGGAGGAACTGCGCCGTCGTCAACTCCCCCTCCAAC

Retrieve as FASTA