Entry information : SiPrx72 (Si017693m)
Entry ID 9563
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiPrx72 (Si017693m)
Name (synonym) SiPrx72 (Si017693m)
Class Class III peroxidase     [Orthogroup: Prx068]*
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx72
start..stop
S start..stop
ZmPrx96 311 3e-105 3..340 4..339
SbPrx58 310 6e-105 1..341 1..345
OsPrx11 308 5e-104 28..341 30..345
ZmPrx44 307 1e-103 1..341 1..345
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 24346366..24346590 225 N° 2 24346811..24347620 810  
join(24346366..24346590,24346811..24347620)


exon

Literature and cross-references SiPrx72 (Si017693m)
DNA ref. Phytozome 12:   scaffold_1 (24346366..24347620)
Protein sequence: SiPrx72 (Si017693m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   346 (322)
PWM (Da):   %s   37916.37 (35476.0)  
PI (pH):   %s   9.44 (9.18) Peptide Signal:   %s   cut: 24 range:24-345
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKLNAALPSLVATLLIVATQSAAGGGQQLTVGYYNAKKCGGVEPIVSDEVYRALAADRSKGAALIRLFFHDCWVKGCDGSVLLDASPRNPYPEKAAGSSIGLRGFDVIDRIKSRLESVYPGVVSCADILAFAARDATRYLSDGHIDYAVPSGRRDGVVSRAKDADDTLPGSTFSFADLKTNFAKKKFDAEELVVLSGAHAIGSAHYPSFRDRLAAPRGEIDARYQTALRNAARNRSRLVANNIRDESYAFKKDAGYPTAPVNGRRDYLNNTYYHNAIDNRVLFRSDWALRTDAFAFGKLKEYRDKPKEWDSDFAEAMVKLSKLPAEGKDFEIRKNCSAINNPSRY*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGCTCAACGCGGCTCTTCCCTCGCTGGTGGCCACCTTGCTCATCGTCGCCACGCAGTCGGCGGCCGGCGGCGGCCAGCAGTTGACGGTCGGTTACTACAACGCCAAGAAATGCGGC
GGCGTGGAGCCCATCGTGTCGGACGAAGTGTACAGGGCCCTCGCCGCCGACCGCAGCAAGGGCGCCGCCCTCATCCGCTTGTTCTTCCATGACTGCTGGGTCAAG
GTACATAACCACATA
TAGTTGTATATGTTTTTTGATGGCTCATATTTTGTATACCTGTTAGTTGAATTTGTGAATGTTCTGCTCTGGTAAAAACAAGTCCCGCTCAAAAAAATTAAATGTTCCATTTCAAAATTT
GAAAATCGACATGAAAAGGGACAGAGTCGTGATCTGTAGAAATGCGCGTTCTGATAACGCTTTTGTACAAATGGAACGTGCCCAGGGCTGCGACGGATCCGTGCTCCTGGACGCGTCACC
AAGGAACCCTTACCCGGAGAAGGCGGCCGGCTCCAGCATCGGCCTCCGTGGCTTCGACGTGATCGACCGGATCAAGTCCAGGCTCGAGTCCGTGTACCCCGGCGTGGTCTCCTGCGCCGA
CATTCTCGCGTTCGCGGCCCGCGACGCGACCCGGTACCTCAGCGACGGGCACATCGACTACGCCGTGCCGTCGGGCCGCCGCGACGGCGTCGTCTCGCGCGCCAAGGACGCCGACGACAC
GCTCCCGGGCTCCACCTTCTCCTTCGCCGACCTCAAGACGAACTTCGCCAAGAAGAAGTTCGACGCCGAGGAGCTCGTCGTGCTCTCCGGCGCGCACGCCATCGGCTCCGCGCACTACCC
GTCGTTCAGGGACCGCCTCGCCGCGCCCCGGGGCGAGATCGACGCCAGGTACCAGACGGCCCTCCGGAACGCCGCCAGGAACAGGTCGAGGCTGGTGGCCAACAACATCCGCGACGAGAG
CTACGCCTTCAAGAAGGACGCCGGGTACCCGACGGCGCCCGTGAACGGCCGGAGGGACTACCTGAACAACACCTACTACCACAACGCCATCGACAACAGGGTGCTCTTCAGGTCCGACTG
GGCGCTGCGCACCGACGCGTTCGCCTTCGGCAAGCTGAAGGAGTACAGGGACAAGCCCAAGGAGTGGGACTCGGACTTCGCCGAAGCCATGGTCAAGCTCAGCAAGCTGCCCGCCGAGGG
CAAGGACTTCGAGATCAGGAAGAACTGCAGCGCCATCAACAACCCGAGCCGCTAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGCTCAACGCGGCTCTTCCCTCGCTGGTGGCCACCTTGCTCATCGTCGCCACGCAGTCGGCGGCCGGCGGCGGCCAGCAGTTGACGGTCGGTTACTACAACGCCAAGAAATGCGGC
GGCGTGGAGCCCATCGTGTCGGACGAAGTGTACAGGGCCCTCGCCGCCGACCGCAGCAAGGGCGCCGCCCTCATCCGCTTGTTCTTCCATGACTGCTGGGTCAAG
GGCTGCGACGGATCC
GTGCTCCTGGACGCGTCACCAAGGAACCCTTACCCGGAGAAGGCGGCCGGCTCCAGCATCGGCCTCCGTGGCTTCGACGTGATCGACCGGATCAAGTCCAGGCTCGAGTCCGTGTACCCC
GGCGTGGTCTCCTGCGCCGACATTCTCGCGTTCGCGGCCCGCGACGCGACCCGGTACCTCAGCGACGGGCACATCGACTACGCCGTGCCGTCGGGCCGCCGCGACGGCGTCGTCTCGCGC
GCCAAGGACGCCGACGACACGCTCCCGGGCTCCACCTTCTCCTTCGCCGACCTCAAGACGAACTTCGCCAAGAAGAAGTTCGACGCCGAGGAGCTCGTCGTGCTCTCCGGCGCGCACGCC
ATCGGCTCCGCGCACTACCCGTCGTTCAGGGACCGCCTCGCCGCGCCCCGGGGCGAGATCGACGCCAGGTACCAGACGGCCCTCCGGAACGCCGCCAGGAACAGGTCGAGGCTGGTGGCC
AACAACATCCGCGACGAGAGCTACGCCTTCAAGAAGGACGCCGGGTACCCGACGGCGCCCGTGAACGGCCGGAGGGACTACCTGAACAACACCTACTACCACAACGCCATCGACAACAGG
GTGCTCTTCAGGTCCGACTGGGCGCTGCGCACCGACGCGTTCGCCTTCGGCAAGCTGAAGGAGTACAGGGACAAGCCCAAGGAGTGGGACTCGGACTTCGCCGAAGCCATGGTCAAGCTC
AGCAAGCTGCCCGCCGAGGGCAAGGACTTCGAGATCAGGAAGAACTGCAGCGCCATCAACAACCCGAGCCGCTAC

Retrieve as FASTA