Entry information : SiPrx85 ( Si020699m)
Entry ID 9576
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-12-07 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-15 (Christophe Dunand)
Peroxidase information: SiPrx85 ( Si020699m)
Name (synonym) SiPrx85 ( Si020699m)
Class Class III peroxidase    [Orthogroup: Prx005]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx85
start..stop
S start..stop
SbPrx24 607 0 7..331 14..336
ZmPrx51 570 0 1..331 2..334
OsPrx97 536 0 27..331 38..342
TaPrx108 506 0 27..331 30..336
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 109399..109620 222 N° 2 108561..109331 771  
complement(join(108561..109331,109399..109620))


exon

Literature and cross-references SiPrx85 ( Si020699m)
DNA ref. Phytozome 12:   scaffold_11 (109620..108561)
Protein sequence: SiPrx85 ( Si020699m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   331 (305)
PWM (Da):   %s   35523.87 (33080.7) Transmb domain:   %s   i7-29o
PI (pH):   %s   6.98 (6.98) Peptide Signal:   %s   cut: 27 range:27-331
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASMAAMVTMGVAALFLSAAASSAMAAGLQMDFYSSTCPRVEEIVKDEMVEILRAAPTLAGPLLRLHFHDCFVRGCDGSVLLDSTPANTAEKDATPNLTLRGFGSVQRVKDRLEQACPGTVSCADILALMARDAVVLARGPSWPVALGRRDGRVSIANETNQLPPPTANFTRLVQMFAAKGLGVKDLVVLSGGHTLGTAHCNLFSDRLYNFTGANNLADVDPALDATYLARLRSRCQSLADNTTLNEMDPGSFLSFDASYYRLVAKRRGLFHSDAALLSDPATRAYVQRQATGLFADEFFRDFADSMVKMSTVDVLTGAQGEIRKKCYLVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (intron 1).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCGATGGCGGCGATGGTCACCATGGGCGTCGCTGCTCTCTTCCTCTCGGCGGCTGCCTCCAGCGCCATGGCTGCTGGGCTGCAGATGGACTTCTACAGCAGCACGTGCCCGCGC
GTGGAGGAGATCGTCAAGGACGAGATGGTGGAGATCCTCAGGGCGGCGCCGACGCTCGCCGGGCCGCTGCTCCGCCTCCACTTCCACGACTGCTTCGTCAGG
GTACGTGCTGCGTTGCTG
CGTATGCATTTGCGTTGCAAGTTACTGAATGCATCGTGCATGGGGACAGGGTTGCGACGGTTCCGTCCTGCTGGACTCGACGCCGGCCAACACGGCGGAGAAGGACGCGACGCCCAACCT
GACCCTCCGCGGCTTCGGCTCCGTGCAGCGTGTCAAGGACCGTCTCGAGCAGGCGTGCCCCGGCACCGTCTCCTGCGCCGACATCCTCGCCCTCATGGCCCGCGACGCCGTCGTCCTTGC
CAGGGGCCCCTCCTGGCCCGTCGCCCTCGGCCGCCGCGACGGCCGCGTCTCCATCGCCAACGAGACCAACCAGCTCCCCCCGCCCACCGCCAACTTCACCCGCCTCGTCCAGATGTTCGC
CGCCAAGGGCCTCGGCGTCAAGGACCTCGTCGTCCTCTCCGGCGGCCACACCCTCGGCACCGCCCACTGCAACCTCTTCAGCGACCGCCTCTACAACTTCACCGGCGCCAACAACCTCGC
GGACGTCGACCCCGCCCTCGACGCCACGTACCTCGCCCGCCTCCGCTCCAGGTGCCAGAGCCTCGCCGACAACACCACCCTCAACGAGATGGACCCCGGCAGCTTCCTCAGCTTCGACGC
CAGCTACTACCGCCTCGTCGCCAAGCGCCGGGGGCTCTTCCACTCCGACGCCGCGCTGCTCAGCGACCCCGCCACCAGGGCGTACGTCCAGCGCCAGGCCACCGGACTCTTCGCGGACGA
GTTCTTCCGTGACTTCGCCGACTCCATGGTCAAGATGTCCACCGTCGACGTGCTCACCGGAGCGCAGGGAGAGATCAGGAAGAAATGCTACCTCGTCAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCGATGGCGGCGATGGTCACCATGGGCGTCGCTGCTCTCTTCCTCTCGGCGGCTGCCTCCAGCGCCATGGCTGCTGGGCTGCAGATGGACTTCTACAGCAGCACGTGCCCGCGC
GTGGAGGAGATCGTCAAGGACGAGATGGTGGAGATCCTCAGGGCGGCGCCGACGCTCGCCGGGCCGCTGCTCCGCCTCCACTTCCACGACTGCTTCGTCAGG
GGTTGCGACGGTTCCGTC
CTGCTGGACTCGACGCCGGCCAACACGGCGGAGAAGGACGCGACGCCCAACCTGACCCTCCGCGGCTTCGGCTCCGTGCAGCGTGTCAAGGACCGTCTCGAGCAGGCGTGCCCCGGCACC
GTCTCCTGCGCCGACATCCTCGCCCTCATGGCCCGCGACGCCGTCGTCCTTGCCAGGGGCCCCTCCTGGCCCGTCGCCCTCGGCCGCCGCGACGGCCGCGTCTCCATCGCCAACGAGACC
AACCAGCTCCCCCCGCCCACCGCCAACTTCACCCGCCTCGTCCAGATGTTCGCCGCCAAGGGCCTCGGCGTCAAGGACCTCGTCGTCCTCTCCGGCGGCCACACCCTCGGCACCGCCCAC
TGCAACCTCTTCAGCGACCGCCTCTACAACTTCACCGGCGCCAACAACCTCGCGGACGTCGACCCCGCCCTCGACGCCACGTACCTCGCCCGCCTCCGCTCCAGGTGCCAGAGCCTCGCC
GACAACACCACCCTCAACGAGATGGACCCCGGCAGCTTCCTCAGCTTCGACGCCAGCTACTACCGCCTCGTCGCCAAGCGCCGGGGGCTCTTCCACTCCGACGCCGCGCTGCTCAGCGAC
CCCGCCACCAGGGCGTACGTCCAGCGCCAGGCCACCGGACTCTTCGCGGACGAGTTCTTCCGTGACTTCGCCGACTCCATGGTCAAGATGTCCACCGTCGACGTGCTCACCGGAGCGCAG
GGAGAGATCAGGAAGAAATGCTACCTCGTCAAC

Retrieve as FASTA