Entry information : SiPrx87 ( Si020718m)
Entry ID 9578
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-12-07 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-15 (Christophe Dunand)
Peroxidase information: SiPrx87 ( Si020718m)
Name (synonym) SiPrx87 ( Si020718m)
Class Class III peroxidase    [Orthogroup: Prx157]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx87
start..stop
S start..stop
SbPrx25 554 0 36..339 41..344
ZmPrx21 548 0 30..339 28..337
TaPrx228-1D 439 4.85e-156 37..339 36..334
TaPrx228-1B 439 8.2e-156 37..339 36..334
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '9578' 'complement(join(105568..106338,106436..106681))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 106436..106681 244 N° 2 105568..106338 769  
complement(join(105568..106338,106436..106681))


exon

Literature and cross-references SiPrx87 ( Si020718m)
DNA ref. Phytozome 12:   scaffold_11 (106681..105568)
Protein sequence: SiPrx87 ( Si020718m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   339 (306)
PWM (Da):   %s   35763.87 (32627.1) Transmb domain:   %s   i12-34o
PI (pH):   %s   7.43 (6.97) Peptide Signal:   %s   cut: 34 range:34-339
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAAATVRTRSLAGGVVPVALLLLVLCTGSSSAAGQLDVGYYNKT
CPAAEEIVRNETAAAVTASPDLAAALLRLHYHDCFVQ
GCDASVLLDSTPNNTAERDAKPNGSLRGFDVVARVKDRLEQACPGTVSCADILALMARDAVSLAKGPSWPVALGRRDGRISSAGSCGELPPLHGDVGLMVQAFAAKGLDLKDLVVLSGAH
TLGKAHCSSYADRLYASAGCSTPDPALDARYADRLRMRCTSPYADDNSTTTTELDPGSSDTFDTSYYRHVARRRGLLRSDASLLDHRFTRAYVLQAASGRYDGHFYHDFAVSMAKMAAIG
VLTGDQGEIRRKCNVVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (intron 1).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGCGGCGGCGACCGTCAGGACGCGCTCGCTCGCCGGCGGCGTTGTGCCGGTGGCACTACTGCTACTCGTCTTGTGTACCGGATCATCATCAGCTGCAGGGCAGCTCGATGTGGGC
TACTACAACAAGACGTGCCCGGCGGCGGAGGAGATCGTGCGCAACGAGACGGCGGCGGCCGTCACGGCGTCGCCGGACCTCGCCGCCGCGCTGCTCAGGCTGCACTACCACGACTGCTTC
GTCCAG
GTACCTACTACCTAGCTGCAGATATTTGACATTACATACATCTTCATCTTGTTACAAACTGCAACAACTCATATTCATAATCCATCCATTATTCCAGGGGGCTGCGACGCGTCG
GTGCTGCTGGACTCGACGCCCAACAACACGGCGGAGCGGGACGCCAAGCCCAACGGCAGCCTCCGCGGCTTCGACGTCGTGGCCCGCGTCAAGGACCGGCTCGAGCAGGCGTGCCCGGGC
ACCGTCTCCTGCGCCGACATCCTGGCCCTCATGGCCCGCGACGCCGTCTCCCTGGCGAAGGGCCCCTCGTGGCCCGTCGCCCTGGGCCGCCGCGACGGCCGCATCTCGAGCGCCGGCAGC
TGCGGCGAGCTTCCCCCGCTGCACGGCGACGTGGGCCTCATGGTCCAGGCCTTCGCCGCCAAGGGCCTCGACCTCAAGGACCTCGTCGTGCTCTCCGGCGCGCACACGCTCGGCAAGGCG
CACTGCTCCTCCTACGCCGACCGCCTTTACGCCTCCGCCGGATGCAGCACCCCCGACCCGGCCCTCGACGCCCGCTACGCCGACAGGCTGCGGATGCGGTGCACCAGCCCCTACGCCGAC
GACAACAGCACCACCACCACGGAGCTCGACCCCGGGAGCTCCGACACCTTCGACACCAGCTACTACCGCCACGTCGCCCGCCGCCGCGGCCTGCTCCGCTCCGACGCATCACTCCTCGAC
CACCGCTTCACCAGGGCTTACGTGCTCCAGGCCGCCTCAGGCAGGTACGACGGACACTTCTACCACGACTTCGCCGTCTCCATGGCCAAGATGGCCGCCATCGGCGTGCTCACCGGAGAC
CAGGGAGAGATCAGGAGAAAGTGCAACGTCGTCAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGCGGCGGCGACCGTCAGGACGCGCTCGCTCGCCGGCGGCGTTGTGCCGGTGGCACTACTGCTACTCGTCTTGTGTACCGGATCATCATCAGCTGCAGGGCAGCTCGATGTGGGC
TACTACAACAAGACGTGCCCGGCGGCGGAGGAGATCGTGCGCAACGAGACGGCGGCGGCCGTCACGGCGTCGCCGGACCTCGCCGCCGCGCTGCTCAGGCTGCACTACCACGACTGCTTC
GTCCAG
GGCTGCGACGCGTCGGTGCTGCTGGACTCGACGCCCAACAACACGGCGGAGCGGGACGCCAAGCCCAACGGCAGCCTCCGCGGCTTCGACGTCGTGGCCCGCGTCAAGGACCGG
CTCGAGCAGGCGTGCCCGGGCACCGTCTCCTGCGCCGACATCCTGGCCCTCATGGCCCGCGACGCCGTCTCCCTGGCGAAGGGCCCCTCGTGGCCCGTCGCCCTGGGCCGCCGCGACGGC
CGCATCTCGAGCGCCGGCAGCTGCGGCGAGCTTCCCCCGCTGCACGGCGACGTGGGCCTCATGGTCCAGGCCTTCGCCGCCAAGGGCCTCGACCTCAAGGACCTCGTCGTGCTCTCCGGC
GCGCACACGCTCGGCAAGGCGCACTGCTCCTCCTACGCCGACCGCCTTTACGCCTCCGCCGGATGCAGCACCCCCGACCCGGCCCTCGACGCCCGCTACGCCGACAGGCTGCGGATGCGG
TGCACCAGCCCCTACGCCGACGACAACAGCACCACCACCACGGAGCTCGACCCCGGGAGCTCCGACACCTTCGACACCAGCTACTACCGCCACGTCGCCCGCCGCCGCGGCCTGCTCCGC
TCCGACGCATCACTCCTCGACCACCGCTTCACCAGGGCTTACGTGCTCCAGGCCGCCTCAGGCAGGTACGACGGACACTTCTACCACGACTTCGCCGTCTCCATGGCCAAGATGGCCGCC
ATCGGCGTGCTCACCGGAGACCAGGGAGAGATCAGGAGAAAGTGCAACGTCGTCAAC

Retrieve as FASTA