Entry information : SiPrx89 (Si022524m)
Entry ID 9580
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-12-07 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-08 (Christophe Dunand)
Peroxidase information: SiPrx89 (Si022524m)
Name (synonym) SiPrx89 (Si022524m)
Class Class III peroxidase    [Orthogroup: Prx207]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx89
start..stop
S start..stop
ZmPrx85 532 0 5..333 8..332
SbPrx99 520 0 35..331 40..336
SpPrx25 382 7e-134 35..332 39..301
OsPrx59 327 1e-111 8..348 14..348
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 244741..244998 258 N° 2 245085..245870 786  
join(244741..244998,245085..245870)


exon

Literature and cross-references SiPrx89 (Si022524m)
DNA ref. Phytozome 12:   scaffold_3 (244741..245870)
Protein sequence: SiPrx89 (Si022524m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   348 (327)
PWM (Da):   %s   36660.57 (34802.5)  
PI (pH):   %s   4.86 (4.86) Peptide Signal:   %s   cut: 22 range:22-348
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPPLAAAVGLLLAAAAVVSARAPLSLTELQATNATSGDGLSVYFHLESCPQLETLVRSNVDAALRQNVRLTAGLLRLFFHDCFPQGCDASILLDNGERNLPPNVGLQQEVLNLIEDIRAKVHAQCGATVSCADITVLATRDAVNLAGGPAFSVSLGRLDSLAPASDNDVFKLPPPTATVDELLSAFNAAGLTDPADLVSLSGAHTVGKARCSAFGAISGPASDDITRCITEPCSAAGSGDRLRDLDFLTPSVFDNIYFIELTLKKNKGVMLPSDQALVTDPRTSWLVQGFADNHWWFFDQFKTSMIKMSNLKGPQGNVGEVRRTCFRRNSAGSTVQNAGDEGLVSPA

Retrieve as FASTA  
Remarks Complete sequence from genomic (intron 1).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCCTCCATTGGCCGCCGCCGTGGGCCTGCTCCTCGCCGCCGCCGCCGTCGTCAGCGCGAGGGCGCCTCTGAGCCTGACTGAGCTGCAGGCTACCAACGCCACCAGCGGCGACGGC
CTGTCGGTGTACTTCCACCTGGAGTCGTGCCCGCAGCTGGAGACCCTCGTCCGCTCCAACGTCGACGCCGCGCTCCGCCAGAACGTCCGCCTCACCGCCGGCCTACTCCGCCTCTTCTTC
CACGACTGCTTCCCGCAG
GTTCCTGTCTTGTTTGTTTCTTCTCCTCTGATAGATATGATGCTGTTCCATCCATCCTAATCCATGGATATGTAAAAAACCAACAGGGCTGCGACGCTTCCA
TCCTCCTGGACAACGGCGAGCGCAACCTCCCCCCCAACGTGGGCCTCCAGCAGGAGGTGCTCAACCTCATCGAGGACATCCGCGCCAAGGTCCACGCCCAGTGCGGCGCCACCGTCTCCT
GCGCCGACATCACCGTCCTCGCCACCCGCGACGCCGTCAACCTGGCCGGCGGCCCCGCCTTCTCCGTGTCCCTGGGCCGCCTCGACAGCCTCGCGCCCGCCTCCGACAACGACGTCTTCA
AGCTCCCCCCGCCCACCGCCACCGTCGACGAGCTCCTCTCCGCCTTCAACGCCGCGGGCCTCACCGACCCGGCCGACCTCGTCTCGCTCTCCGGCGCCCACACCGTGGGGAAGGCGCGCT
GCAGCGCGTTCGGCGCCATCTCCGGCCCCGCCAGCGACGACATCACGAGGTGCATCACGGAGCCGTGCTCGGCGGCGGGCAGCGGCGACCGGCTGCGGGACCTGGACTTCCTGACCCCCA
GCGTGTTCGACAACATCTACTTCATCGAGCTGACGCTGAAGAAGAACAAGGGGGTGATGCTGCCGTCGGACCAGGCTCTGGTGACGGACCCGCGCACCAGCTGGCTCGTCCAGGGATTCG
CCGACAACCACTGGTGGTTCTTCGACCAGTTCAAGACCTCCATGATCAAGATGAGCAACCTCAAGGGCCCACAGGGAAACGTCGGCGAGGTCAGGCGCACCTGCTTCAGGCGCAACTCCG
CCGGCTCCACCGTCCAGAACGCCGGCGACGAGGGCCTTGTCTCCCCTGCT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCCTCCATTGGCCGCCGCCGTGGGCCTGCTCCTCGCCGCCGCCGCCGTCGTCAGCGCGAGGGCGCCTCTGAGCCTGACTGAGCTGCAGGCTACCAACGCCACCAGCGGCGACGGC
CTGTCGGTGTACTTCCACCTGGAGTCGTGCCCGCAGCTGGAGACCCTCGTCCGCTCCAACGTCGACGCCGCGCTCCGCCAGAACGTCCGCCTCACCGCCGGCCTACTCCGCCTCTTCTTC
CACGACTGCTTCCCGCAG
GGCTGCGACGCTTCCATCCTCCTGGACAACGGCGAGCGCAACCTCCCCCCCAACGTGGGCCTCCAGCAGGAGGTGCTCAACCTCATCGAGGACATCCGCGCC
AAGGTCCACGCCCAGTGCGGCGCCACCGTCTCCTGCGCCGACATCACCGTCCTCGCCACCCGCGACGCCGTCAACCTGGCCGGCGGCCCCGCCTTCTCCGTGTCCCTGGGCCGCCTCGAC
AGCCTCGCGCCCGCCTCCGACAACGACGTCTTCAAGCTCCCCCCGCCCACCGCCACCGTCGACGAGCTCCTCTCCGCCTTCAACGCCGCGGGCCTCACCGACCCGGCCGACCTCGTCTCG
CTCTCCGGCGCCCACACCGTGGGGAAGGCGCGCTGCAGCGCGTTCGGCGCCATCTCCGGCCCCGCCAGCGACGACATCACGAGGTGCATCACGGAGCCGTGCTCGGCGGCGGGCAGCGGC
GACCGGCTGCGGGACCTGGACTTCCTGACCCCCAGCGTGTTCGACAACATCTACTTCATCGAGCTGACGCTGAAGAAGAACAAGGGGGTGATGCTGCCGTCGGACCAGGCTCTGGTGACG
GACCCGCGCACCAGCTGGCTCGTCCAGGGATTCGCCGACAACCACTGGTGGTTCTTCGACCAGTTCAAGACCTCCATGATCAAGATGAGCAACCTCAAGGGCCCACAGGGAAACGTCGGC
GAGGTCAGGCGCACCTGCTTCAGGCGCAACTCCGCCGGCTCCACCGTCCAGAACGCCGGCGACGAGGGCCTTGTCTCCCCTGCT

Retrieve as FASTA