Entry information : SiPrx90 (Si022555m)
Entry ID 9581
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-12-14 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-12-07 (Qiang Li)
Peroxidase information: SiPrx90 (Si022555m)
Name (synonym) SiPrx90 (Si022555m)
Class Class III peroxidase    [Orthogroup: Prx162]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx90
start..stop
S start..stop
SbPrx127 615 0 1..336 1..347
ZmPrx102 584 0 25..336 23..340
OsPrx75 510 0 35..336 37..349
BdiPrx70 481 1e-172 33..336 34..341
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 14381580..14381819 240 N° 2 14381283..14381474 192 N° 3 14381023..14381188 166 N° 4 14380750..14380879 130
N° 5 14380443..14380722 280  
complement(join(14380443..14380722,14380750..14380879,14381023..14381188,1438128 3..14381474,14381580..14381819))


exon

Literature and cross-references SiPrx90 (Si022555m)
DNA ref. Phytozome 12:   scaffold_3 (14381819..14380443)
Protein sequence: SiPrx90 (Si022555m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   336 (308)
PWM (Da):   %s   36747.51 (33685.7) Transmb domain:   %s   i13-35o
PI (pH):   %s   6.31 (5.62) Peptide Signal:   %s   cut: 29 range:29-336
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MWRERQRLRPPPPLLVAAAALVVVSALASAPEAALQVGFYHETCPIAEDVVLAEMRLILMEDATVAPALLRMHYHDCFVQGCDGSIMLRSRKKGNKTERDALPNRSMRGYDAIERIKARLEAVCPLTVSCADIIAMAARDAVYLSHGPWYDVETGRRDGNLTVAEYVENDLPPPDSNIVDVKTFFSVKSLNSKDIAVLFGCHSIGTSHCGPIQKRLYNFTGSMDQDPSLNPDYAAELKKLCPPGEGKTKVPLDPGSNYTFDLSYYRHVLATGGLFQSDGSLLHDPVTRGYVEKVAKAKSPDEYYADFAAAMVKMGRTDVLVGDLGEIRPTCGIFV

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTGGAGGGAGCGGCAGCGGCTGCGGCCACCGCCGCCGCTTCTAGTGGCGGCTGCGGCCCTGGTGGTGGTCAGCGCGCTCGCGAGCGCGCCGGAGGCCGCGCTGCAGGTCGGATTCTAC
CACGAGACGTGCCCGATCGCGGAGGACGTCGTCCTCGCGGAGATGAGGCTCATCCTCATGGAGGACGCCACGGTCGCGCCGGCCCTGCTCCGGATGCACTACCACGACTGCTTCGTGCAG
GTAAAACAACCTGCCTATAGCTACCTGCTCCGTTCTGTTCAGCATGAGGGTTCGTGCGTGCCTGGTGATCCTGATCCTCTGCTTGCTCTGTTATTTCGTGCGAAGGGCTGCGACGGATCG
ATCATGCTCCGGTCGAGGAAGAAGGGGAACAAGACGGAGCGGGACGCGCTCCCCAACCGCAGCATGCGAGGGTACGACGCCATCGAGCGGATCAAGGCCCGGCTCGAGGCCGTCTGCCCG
CTCACCGTCTCCTGCGCCGACATCATCGCCATGGCCGCCAGGGACGCCGTCTACCTG
GTGAGCCGCCATCGAACCGAGCTCTCTGGAGCCGTTCTCGTTGTGCTTTGCTTTGCTCTTTTG
CTGACCGTGAATGCTCGCTTGGTACGTTCAGAGCCACGGGCCGTGGTACGACGTGGAGACCGGGCGGCGCGACGGCAACCTCACCGTGGCGGAGTACGTCGAGAACGACCTGCCGCCGCC
GGACTCCAACATCGTCGACGTCAAGACCTTCTTCAGCGTCAAGTCGCTCAACTCCAAGGACATCGCCGTCCTCTTCG
GTACCTCTCGCTGCCCGCCCACCCGCCTACTCCTCCTCCTTTC
CTTTCCTTTCCGCGTGAGCGACAGCAACGGCTTAGCCGAGCCAACCACTCCACTCGACCGCTAGCTAACGGCCGCGTCGCCTCCGACACGTACTGCGCAGGGTGCCACAGCATCGGGACC
TCCCACTGCGGCCCGATCCAGAAGCGGCTCTACAACTTCACCGGCAGCATGGACCAGGACCCGTCGCTGAACCCGGACTACGCTGCCGAGCTCAAGAAGCTCTGCCCGCC
GCCCCGTCCC
GGCGTCGACGACGACGGCGGCGAAGGGAAGACCAAGGTGCCCCTGGACCCCGGCAGCAACTACACCTTCGACCTGAGCTACTACCGGCACGTGCTCGCCACAGGCGGGTTGTTCCAGTCC
GACGGCAGCCTCCTCCACGACCCCGTCACCAGGGGGTACGTCGAGAAGGTGGCCAAGGCGAAGTCGCCGGACGAGTACTACGCCGACTTCGCCGCGGCGATGGTCAAGATGGGCCGCACC
GACGTGCTCGTCGGCGACCTCGGGGAGATCAGGCCGACCTGCGGCATTTTTGTTGAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTGGAGGGAGCGGCAGCGGCTGCGGCCACCGCCGCCGCTTCTAGTGGCGGCTGCGGCCCTGGTGGTGGTCAGCGCGCTCGCGAGCGCGCCGGAGGCCGCGCTGCAGGTCGGATTCTAC
CACGAGACGTGCCCGATCGCGGAGGACGTCGTCCTCGCGGAGATGAGGCTCATCCTCATGGAGGACGCCACGGTCGCGCCGGCCCTGCTCCGGATGCACTACCACGACTGCTTCGTGCAG
GGCTGCGACGGATCGATCATGCTCCGGTCGAGGAAGAAGGGGAACAAGACGGAGCGGGACGCGCTCCCCAACCGCAGCATGCGAGGGTACGACGCCATCGAGCGGATCAAGGCCCGGCTC
GAGGCCGTCTGCCCGCTCACCGTCTCCTGCGCCGACATCATCGCCATGGCCGCCAGGGACGCCGTCTACCTG
AGCCACGGGCCGTGGTACGACGTGGAGACCGGGCGGCGCGACGGCAAC
CTCACCGTGGCGGAGTACGTCGAGAACGACCTGCCGCCGCCGGACTCCAACATCGTCGACGTCAAGACCTTCTTCAGCGTCAAGTCGCTCAACTCCAAGGACATCGCCGTCCTCTTCG
GG
TGCCACAGCATCGGGACCTCCCACTGCGGCCCGATCCAGAAGCGGCTCTACAACTTCACCGGCAGCATGGACCAGGACCCGTCGCTGAACCCGGACTACGCTGCCGAGCTCAAGAAGCTC
TGCCCGCC
CGGCGAAGGGAAGACCAAGGTGCCCCTGGACCCCGGCAGCAACTACACCTTCGACCTGAGCTACTACCGGCACGTGCTCGCCACAGGCGGGTTGTTCCAGTCCGACGGCAGC
CTCCTCCACGACCCCGTCACCAGGGGGTACGTCGAGAAGGTGGCCAAGGCGAAGTCGCCGGACGAGTACTACGCCGACTTCGCCGCGGCGATGGTCAAGATGGGCCGCACCGACGTGCTC
GTCGGCGACCTCGGGGAGATCAGGCCGACCTGCGGCATTTTTGTTGAC

Retrieve as FASTA