Entry information : SiPrx91 (Si022557m)
Entry ID 9582
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-12-07 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-08 (Christophe Dunand)
Peroxidase information: SiPrx91 (Si022557m)
Name (synonym) SiPrx91 (Si022557m)
Class Class III peroxidase    [Orthogroup: Prx104]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx91
start..stop
S start..stop
SbPrx108 609 0 20..342 19..341
SofPrx12 601 0 25..344 22..342
ZmPrx104 588 0 21..344 22..354
ZmPrx[P]75 568 0 13..343 1..337
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3314724..3314945 222 N° 2 3316839..3317648 810  
join(3314724..3314945,3316839..3317648)


exon

Literature and cross-references SiPrx91 (Si022557m)
DNA ref. Phytozome 12:   scaffold_3 (3314724..3317648)
Protein sequence: SiPrx91 (Si022557m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   344 (318)
PWM (Da):   %s   37312.3 (34819.9) Transmb domain:   %s   i5-24o
PI (pH):   %s   8.33 (8.40) Peptide Signal:   %s   cut: 27 range:27-344
Sequence 385
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTTKVSAALLCAAALLLVVAPLAAEASELKLGYYKKTCPGWKNVVKYHVAKAIRANRGSGAALVRLIFHDCFVRGCDASVLLDPTPANPHTEKTAPINIGLAAFEVIDDIKAALEERCPGTVSCSDIVVFAARDASSILSNGHVHFDPPAGRLDGPISRAADAQRDLPDSTFTIGELIRNFRRKNFTVEELVILSGAHAIGVGHCSSFRGRLSSPPSQIVPAYRNLLSAKCAAGPDPVVTNNVRDEDPSAVAAAFPSFLKKLRKNKDFLDNSYYHNNLARIVTFNSDWQLLTEKEALGHVKEYAENGTLWDEDFSDALVKLSKLPMPPHSKGEIRKHCRFLNHH

Retrieve as FASTA  
Remarks Complete sequence from genomic (intron 1).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGACGACGAAAGTGTCGGCGGCGCTGCTGTGCGCGGCGGCGCTGCTGCTGGTGGTGGCGCCGCTGGCGGCGGAGGCGAGCGAGCTCAAGCTGGGCTACTACAAGAAGACCTGCCCGGGGT
GGAAGAACGTGGTCAAGTACCACGTCGCCAAGGCCATCAGGGCCAACCGCGGCAGCGGCGCCGCCCTCGTCCGCCTCATCTTCCACGACTGCTTCGTCAGG
GTACGTGCCGCGCCGCCGT
CGTAACTCACCACGCACAACACAGCTCCTCTCCGCCCATAGCTATTAGCTCAGTTCGTTCGTCCGTGTAGCTAGCTACCTAGCTCACGCCATTGTCGACCAGCACGTTCGCGCCTGTCAT
TCCGTCAACGTCTCAAGGACATTTCTTAGTCTCCAAAAAAAAAGTAATACTCGAGTATACCAGGAGAATTGGTTTAATTAGTCAAATAGTTCATGGTTACAAAGGGCTAACCTTCCATTC
CAACCACACTTTTTACAGGTGCCAACATAGTTTCGCTAAAAATAGTACTCATGCTTACGTGACAAAAATTGTCCCCCCCCCCCTAAAGCATGTAACAGCCGACCGAAGCAGCACCTGCAT
TGTACACGGACTAATTTTGAGCAAGTACCAAAACTGTCAACACTAACAACCGTTGTTTAACCATCTGTCACCTTACCTACCTGGAAAGCGTTTACATACAACCGAGAGTCCTAACGGCAT
ACTCCTCCATCACTTTGGAGCTTCTTTACCGATCGATAAGAAAGTTCCTTGTAGCTTAGCTCCTCTAGCAAGCTGTCCAAACATCTTTCGTTCGCCAATCGTCATCATTGCTGCTGTCGT
CCACGAATAGTCTGATGTGGATGAGTTTCGTGCGCCGGTTGTTCACTCCAACATGGCGCGCAAAAGAGACTTTATTTTTCTGCTTAGCTAGCTGGAGAATCGGTCACGAATGCGATACTT
TCCTTGGAGTACTTAGATACATCTTTTTCCCTGTATCGATTTGACATGTCCAAGACTTCCTTTCAGGTAGGCCCCCCAGGAATGGTGTGTCCTCCTTGTCTTTGCTGACTGTAGCTTACA
TGTGTTCCTGATTGCTAAATGAACGATAACTAACGTGCAACTACCAGGGGTTCATTTAACTATAACTTCTAGTTTCGACTGGACAATCAGTCACATTGTCCTGCAGTTTCATCCAGGGGA
AAAAAATGAAATCTTTATTTACGAATAATCAGCTACATAGTAGTACATACCACTGTTCATAAAAGAATTGGCCATCATATATCCTGTCCCTGTTAGACATGTGGAAGTTTTCCTAACTAA
TCTGCAAACCCATGTGGTGCGGAATGAATGGGATGTAGAGATAGAGCGAGGTTGTTCATTTGCTCTTTGCTTATTTTTATAGCATGGAAAGCATAGTTGGAAAGGGCTACAAGGAAGAGA
AAATTAAGATGACTAGCGTTAGTCACACACACTTGCACATCTACATCAATCATTGGTTGCACTAGTCCTCCAAATTAAAGGCCCTGAAAATCTTATGCATATATAGGAAAGCTCCAAGGC
TCCAACTAACAATAATGTTTCTTGTTTGAAAAAAGGGCACGCATTTGTAAATAGTGGGCATGCCTTTAAAAAATGGTCCTATGCTAAAGGATGGCAATATGATCAACAGACTATTTCTGC
AAAAAGCGTCTTCAGTAGAACAATAAACAGTTCAACAATAATGGTCCAATAACTCACAAGCCACCCCCCCTGCCGACACTACATATGAACATCCTTTTCCAACAACTGAGCCGAGCACGT
TCGAGGTCCAAACAAAGATATAATTACGCGCTCAGTACCGACGAAATGACTTGCCATGCACACTTGACACGTCACTCTACAGCAACAGCACTAGCTAGTAGTTGGGCCATCTGATTGCAA
TGCAGTACGTACTAGTAGTAGGGTGGTTCATTAATGCAGTGTCTTAATCTCACTTCAATAATTCCGTCATCTCTCGATTACCACTAGCTTAAGCTACATATGACATGAGTGAATTACAGA
CACGTACGTGCGTGGTGATTCATTTTTTCATATGATCGAGCTATCCGATCGATTGACGGTGACTGGCGGTGCAGGGTTGCGACGCGTCGGTGCTGCTGGACCCGACGCCGGCGAACCCGC
ACACGGAGAAGACGGCGCCGATCAACATCGGCCTCGCGGCGTTCGAGGTGATCGACGACATCAAGGCGGCGCTGGAGGAGCGGTGCCCCGGCACGGTGTCCTGCTCCGACATCGTGGTGT
TCGCCGCCCGCGACGCGTCCAGCATCCTGAGCAACGGGCACGTCCACTTCGACCCCCCCGCGGGGCGCCTCGACGGCCCCATCTCCCGCGCCGCCGACGCACAGCGGGACCTCCCGGACT
CCACCTTCACAATCGGCGAGCTGATCCGCAACTTCCGGCGCAAGAACTTCACGGTGGAGGAGCTGGTGATCCTCTCCGGCGCGCACGCCATCGGCGTCGGCCACTGCTCCTCCTTCCGCG
GGCGGCTGTCCTCGCCGCCGAGCCAGATCGTGCCGGCGTACCGGAACCTGCTGTCGGCGAAGTGCGCGGCGGGGCCCGACCCCGTGGTGACGAACAACGTGCGGGACGAGGACCCGAGCG
CCGTGGCGGCGGCGTTCCCGTCGTTCCTGAAGAAGCTGAGGAAGAACAAGGACTTCCTGGACAACAGCTACTACCACAACAACCTGGCCCGGATCGTGACGTTCAACTCGGACTGGCAGC
TGCTGACGGAGAAGGAGGCGCTGGGGCACGTCAAGGAGTACGCCGAGAACGGGACGCTCTGGGACGAGGACTTCTCCGATGCGCTCGTCAAGCTCAGCAAGCTGCCCATGCCGCCCCACA
GCAAGGGGGAGATCAGGAAGCACTGCCGCTTCCTCAACCACCAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGACGACGAAAGTGTCGGCGGCGCTGCTGTGCGCGGCGGCGCTGCTGCTGGTGGTGGCGCCGCTGGCGGCGGAGGCGAGCGAGCTCAAGCTGGGCTACTACAAGAAGACCTGCCCGGGGT
GGAAGAACGTGGTCAAGTACCACGTCGCCAAGGCCATCAGGGCCAACCGCGGCAGCGGCGCCGCCCTCGTCCGCCTCATCTTCCACGACTGCTTCGTCAGG
GGTTGCGACGCGTCGGTGC
TGCTGGACCCGACGCCGGCGAACCCGCACACGGAGAAGACGGCGCCGATCAACATCGGCCTCGCGGCGTTCGAGGTGATCGACGACATCAAGGCGGCGCTGGAGGAGCGGTGCCCCGGCA
CGGTGTCCTGCTCCGACATCGTGGTGTTCGCCGCCCGCGACGCGTCCAGCATCCTGAGCAACGGGCACGTCCACTTCGACCCCCCCGCGGGGCGCCTCGACGGCCCCATCTCCCGCGCCG
CCGACGCACAGCGGGACCTCCCGGACTCCACCTTCACAATCGGCGAGCTGATCCGCAACTTCCGGCGCAAGAACTTCACGGTGGAGGAGCTGGTGATCCTCTCCGGCGCGCACGCCATCG
GCGTCGGCCACTGCTCCTCCTTCCGCGGGCGGCTGTCCTCGCCGCCGAGCCAGATCGTGCCGGCGTACCGGAACCTGCTGTCGGCGAAGTGCGCGGCGGGGCCCGACCCCGTGGTGACGA
ACAACGTGCGGGACGAGGACCCGAGCGCCGTGGCGGCGGCGTTCCCGTCGTTCCTGAAGAAGCTGAGGAAGAACAAGGACTTCCTGGACAACAGCTACTACCACAACAACCTGGCCCGGA
TCGTGACGTTCAACTCGGACTGGCAGCTGCTGACGGAGAAGGAGGCGCTGGGGCACGTCAAGGAGTACGCCGAGAACGGGACGCTCTGGGACGAGGACTTCTCCGATGCGCTCGTCAAGC
TCAGCAAGCTGCCCATGCCGCCCCACAGCAAGGGGGAGATCAGGAAGCACTGCCGCTTCCTCAACCACCAC

Retrieve as FASTA