Entry information : SiPrx95 (Si022622m)
Entry ID 9586
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-12-07 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-08 (Christophe Dunand)
Peroxidase information: SiPrx95 (Si022622m)
Name (synonym) SiPrx95 (Si022622m)
Class Class III peroxidase     [Orthogroup: Prx057]*
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx95
start..stop
S start..stop
SbPrx101 327 1.3e-111 8..324 6..324
SiPrx98 314 6.56e-107 33..319 25..307
OsPrx61 291 7.06e-98 14..315 20..325
ZmPrx[P]47 291 1.56e-97 12..325 15..334
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '9586' 'join(230497..230730,230826..231587)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 230497..230730 232 N° 2 230826..231587 760  
join(230497..230730,230826..231587)


exon

Literature and cross-references SiPrx95 (Si022622m)
DNA ref. Phytozome 12:   scaffold_3 (230497..231587)
Protein sequence: SiPrx95 (Si022622m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   332 (304)
PWM (Da):   %s   35138.02 (32499.6) Transmb domain:   %s   i7-26o
PI (pH):   %s   7.29 (6.89) Peptide Signal:   %s   cut: 29 range:29-332
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARRGNALAMGTLLLAAAVVCAAAAAEADDLLVELQLQQDPCPQV
EDIVRSAVQKAVRRNIQLTAGLLRIFFHDCFPQ
GCDASVLLAGERDVPPNAGSLQPEALKLIEDIRREVHGKCGGPKVSCADILALATRDAVVAAGLPFFPITRGRMDTRTPAPDVLGNLPSPSDSVGNLLDMFRRKGLGDDPRVLVALSGGH
TVGKTSCGLIRGNDDFSRALAANCSASRSRKQSLDVITPDAFDNRYFVALRNGKGVLGSDQGLADHPSTRDIVRDFANDQQLFFTQFRASMTKLSQLKAPAGGSRFEIRLDCSKPNARVG
DEDDAAAGQLAAAA

Retrieve as FASTA  
Remarks Complete sequence from genomic (intron 1).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAAGGAGGGGTAATGCCCTGGCCATGGGGACCCTGCTGCTCGCCGCCGCCGTGGTCTGCGCGGCAGCTGCAGCAGAAGCAGATGATCTGTTGGTGGAGCTCCAGCTGCAGCAAGAC
CCGTGCCCGCAGGTGGAAGACATCGTGCGCTCTGCCGTGCAGAAGGCGGTCCGCCGGAATATCCAGCTCACCGCCGGCCTCCTCCGCATCTTCTTCCACGACTGCTTCCCGCAG
AGGTTG
TGCAGTGCTTTCGATCCGTTAGTTAATAATTCTCTGCAAGCAAAAGACTTAATTCCGAAAATGCATGAAAAAAATACACTACGACATACAGGGCTGCGACGCGTCGGTCCTCCTTGCCGG
CGAGCGTGACGTTCCTCCGAACGCCGGGTCGCTGCAGCCGGAGGCGCTGAAGCTGATCGAGGACATCCGCCGGGAGGTGCACGGCAAGTGCGGCGGGCCCAAGGTGTCGTGCGCCGACAT
CCTCGCGCTCGCCACGCGGGACGCCGTCGTCGCCGCCGGCCTGCCCTTCTTCCCCATAACCCGGGGCCGCATGGACACCCGCACGCCCGCTCCCGACGTGCTCGGGAACCTCCCGTCGCC
ATCCGACTCGGTGGGCAATCTCCTCGACATGTTCCGCCGCAAGGGCCTCGGCGACGACCCGCGCGTCCTGGTGGCCCTCTCCGGCGGGCACACCGTCGGCAAGACCAGCTGCGGCCTGAT
CAGGGGGAACGACGATTTCTCCAGGGCCCTGGCGGCCAACTGCTCCGCCAGCCGGAGCAGGAAGCAGAGCCTGGACGTGATCACGCCGGACGCCTTCGACAACAGGTACTTCGTGGCGCT
GAGGAACGGCAAGGGGGTGCTCGGGTCCGACCAGGGGCTGGCCGACCACCCCAGCACCAGGGACATTGTTAGGGATTTCGCCAACGACCAGCAGCTCTTCTTCACACAGTTCCGCGCCTC
CATGACCAAGCTCAGCCAGCTGAAAGCGCCCGCGGGTGGAAGCAGGTTCGAGATCCGCCTCGACTGCTCCAAGCCCAACGCCCGTGTCGGAGACGAAGACGATGCCGCCGCCGGCCAACT
TGCAGCCGCGGCC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAAGGAGGGGTAATGCCCTGGCCATGGGGACCCTGCTGCTCGCCGCCGCCGTGGTCTGCGCGGCAGCTGCAGCAGAAGCAGATGATCTGTTGGTGGAGCTCCAGCTGCAGCAAGAC
CCGTGCCCGCAGGTGGAAGACATCGTGCGCTCTGCCGTGCAGAAGGCGGTCCGCCGGAATATCCAGCTCACCGCCGGCCTCCTCCGCATCTTCTTCCACGACTGCTTCCCGCAG
GGCTGC
GACGCGTCGGTCCTCCTTGCCGGCGAGCGTGACGTTCCTCCGAACGCCGGGTCGCTGCAGCCGGAGGCGCTGAAGCTGATCGAGGACATCCGCCGGGAGGTGCACGGCAAGTGCGGCGGG
CCCAAGGTGTCGTGCGCCGACATCCTCGCGCTCGCCACGCGGGACGCCGTCGTCGCCGCCGGCCTGCCCTTCTTCCCCATAACCCGGGGCCGCATGGACACCCGCACGCCCGCTCCCGAC
GTGCTCGGGAACCTCCCGTCGCCATCCGACTCGGTGGGCAATCTCCTCGACATGTTCCGCCGCAAGGGCCTCGGCGACGACCCGCGCGTCCTGGTGGCCCTCTCCGGCGGGCACACCGTC
GGCAAGACCAGCTGCGGCCTGATCAGGGGGAACGACGATTTCTCCAGGGCCCTGGCGGCCAACTGCTCCGCCAGCCGGAGCAGGAAGCAGAGCCTGGACGTGATCACGCCGGACGCCTTC
GACAACAGGTACTTCGTGGCGCTGAGGAACGGCAAGGGGGTGCTCGGGTCCGACCAGGGGCTGGCCGACCACCCCAGCACCAGGGACATTGTTAGGGATTTCGCCAACGACCAGCAGCTC
TTCTTCACACAGTTCCGCGCCTCCATGACCAAGCTCAGCCAGCTGAAAGCGCCCGCGGGTGGAAGCAGGTTCGAGATCCGCCTCGACTGCTCCAAGCCCAACGCCCGTGTCGGAGACGAA
GACGATGCCGCCGCCGGCCAACTTGCAGCCGCGGCC

Retrieve as FASTA