Entry information : SiPrx97 (Si022667m)
Entry ID 9588
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-12-07 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-08 (Christophe Dunand)
Peroxidase information: SiPrx97 (Si022667m)
Name (synonym) SiPrx97 (Si022667m)
Class Class III peroxidase    [Orthogroup: Prx052]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx97
start..stop
S start..stop
SiPrx101 532 0 1..324 1..317
SbPrx120 530 0 3..324 2..320
SbPrx119 521 0 3..324 2..322
SbPrx124 519 0 1..324 1..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 19594234..19594692 459 N° 2 19593948..19594110 163 N° 3 19593486..19593835 350  
complement(join(19593486..19593835,19593948..19594110,19594234..19594692))


exon

Literature and cross-references SiPrx97 (Si022667m)
DNA ref. Phytozome 12:   scaffold_3 (19594692..19593486)
Protein sequence: SiPrx97 (Si022667m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324 (291)
PWM (Da):   %s   34515.4 (31508.9) Transmb domain:   %s   i7-29o
PI (pH):   %s   7.12 (6.99) Peptide Signal:   %s   cut: 34 range:34-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAASSSSSSSAAVVLAAHCAVLLMLALAGAAHGNPPSSAGSVLSSTFYDASCPSAHDVVRRVIQDARVSDPRIPASLIRLHFHDCFVQGCDGSLLLDDDLPAIKTEKTVPANNKSARGFEVVDDIKSALEEACPGIVSCADILALAAEISVELAGGPRWRVLLGRRDGTATNIQSARNLPNFFDPLNVLQEKFRNVNLDDADLVALQGAHTFGKVQCQFTRENCTAGQSRGALENLDQVTPNRFDNKYYGNLLEGRAQLPSDQVMLSDPAAAATTAPIVHRFASNQKDFFRNFAASMIKMGNISPLTGKDGEIRKNCRRVNKG

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 2 and 3).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGCTTCCTCCTCCTCCTCCTCATCTGCCGCGGTGGTGCTAGCGGCGCACTGCGCCGTCTTGCTCATGCTCGCCCTGGCCGGAGCCGCTCACGGCAACCCTCCTAGTAGCGCCGGC
TCGGTGCTGAGCTCGACGTTCTACGACGCGTCGTGCCCCAGCGCCCACGACGTCGTCCGCCGCGTGATCCAGGACGCCAGGGTCTCCGACCCGCGCATCCCGGCAAGCCTCATCCGCCTC
CACTTCCACGACTGCTTCGTTCAGGGCTGCGACGGCTCGCTCCTCCTTGACGACGACCTCCCGGCCATCAAGACCGAGAAGACTGTGCCGGCCAACAACAAATCGGCGCGCGGCTTTGAG
GTGGTCGACGACATCAAGAGCGCTCTGGAGGAAGCGTGCCCAGGCATCGTTTCCTGCGCCGACATCCTTGCTCTCGCGGCTGAGATCTCCGTCGAACTC
GTAAGCACCAGACACCAGATA
TCTTGAGTTCTTCCATTGAAGAACGATCATAACTAGCTTCCCGACGCTGTTCAAGGCTTAGTTAGTTTTCCTTAACTGACGAAACCATGGAACTGCTTGCAGGCTGGAGGGCCACGATGG
AGGGTGCTCCTCGGCCGGCGAGACGGCACGGCGACCAACATCCAGAGCGCCAGAAACCTACCCAACTTCTTCGACCCCCTGAACGTCCTCCAGGAGAAGTTCAGAAACGTCAACCTGGAC
GACGCTGACCTCGTCGCTCTCCAAG
GTAATTAACGTGCTCACACAAGCAACACCATTTCAGCAGATACAGTGCAAATCTTGCTAGAAATTTCTGGTAGCGTACGATGGGCCTTACTAAAT
TTGTACTTCGCGATCAGGTGCGCACACATTCGGTAAGGTGCAGTGTCAGTTCACGAGGGAGAACTGCACGGCCGGCCAATCCAGAGGTGCACTGGAGAACCTGGACCAGGTCACACCCAA
CCGGTTCGACAACAAGTATTACGGCAACCTGTTGGAGGGCCGCGCTCAGCTCCCGTCAGACCAGGTTATGCTGTCGGACCCTGCCGCGGCGGCGACCACTGCTCCCATTGTCCATCGGTT
CGCAAGCAACCAAAAGGATTTCTTCAGGAACTTCGCGGCGTCCATGATTAAAATGGGAAACATTAGCCCGCTGACAGGGAAGGATGGGGAGATCAGGAAGAACTGCCGGAGGGTTAACAA
AGGCTAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGCTTCCTCCTCCTCCTCCTCATCTGCCGCGGTGGTGCTAGCGGCGCACTGCGCCGTCTTGCTCATGCTCGCCCTGGCCGGAGCCGCTCACGGCAACCCTCCTAGTAGCGCCGGC
TCGGTGCTGAGCTCGACGTTCTACGACGCGTCGTGCCCCAGCGCCCACGACGTCGTCCGCCGCGTGATCCAGGACGCCAGGGTCTCCGACCCGCGCATCCCGGCAAGCCTCATCCGCCTC
CACTTCCACGACTGCTTCGTTCAGGGCTGCGACGGCTCGCTCCTCCTTGACGACGACCTCCCGGCCATCAAGACCGAGAAGACTGTGCCGGCCAACAACAAATCGGCGCGCGGCTTTGAG
GTGGTCGACGACATCAAGAGCGCTCTGGAGGAAGCGTGCCCAGGCATCGTTTCCTGCGCCGACATCCTTGCTCTCGCGGCTGAGATCTCCGTCGAACTC
GCTGGAGGGCCACGATGGAGG
GTGCTCCTCGGCCGGCGAGACGGCACGGCGACCAACATCCAGAGCGCCAGAAACCTACCCAACTTCTTCGACCCCCTGAACGTCCTCCAGGAGAAGTTCAGAAACGTCAACCTGGACGAC
GCTGACCTCGTCGCTCTCCAAG
GTGCGCACACATTCGGTAAGGTGCAGTGTCAGTTCACGAGGGAGAACTGCACGGCCGGCCAATCCAGAGGTGCACTGGAGAACCTGGACCAGGTCACA
CCCAACCGGTTCGACAACAAGTATTACGGCAACCTGTTGGAGGGCCGCGCTCAGCTCCCGTCAGACCAGGTTATGCTGTCGGACCCTGCCGCGGCGGCGACCACTGCTCCCATTGTCCAT
CGGTTCGCAAGCAACCAAAAGGATTTCTTCAGGAACTTCGCGGCGTCCATGATTAAAATGGGAAACATTAGCCCGCTGACAGGGAAGGATGGGGAGATCAGGAAGAACTGCCGGAGGGTT
AACAAAGGCTAC

Retrieve as FASTA