Entry information : SiPrx99 (Si022679m)
Entry ID 9590
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-12-14 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-14 (Qiang Li)
Peroxidase information: SiPrx99 (Si022679m)
Name (synonym) SiPrx99 (Si022679m)
Class Class III peroxidase    [Orthogroup: Prx141]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx99
start..stop
S start..stop
SiPrx104 499 5e-180 1..321 1..323
SbPrx111 493 1e-177 1..321 1..323
SbPrx109 484 5e-174 1..321 1..323
ZmPrx129 446 5e-159 1..321 1..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3330383..3330595 213 N° 2 3330990..3331739 750  
join(3330383..3330595,3330990..3331739)


exon

Literature and cross-references SiPrx99 (Si022679m)
DNA ref. Phytozome 12:   scaffold_3 (3330383..3331739)
Protein sequence: SiPrx99 (Si022679m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   321 (297)
PWM (Da):   %s   32936.32 (30690.2)  
PI (pH):   %s   5.75 (5.75) Peptide Signal:   %s   cut: 25 range:25-321
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATSACQALLLMALAAAVLSTASGTLKYDFYSLSCPKAEEAVRNATMKIISDKPSMGAAFVRLYFHDCFVKGCDASILLNQSNSNPQPEKLGIPLRGYDEVNTIKAAVEAVCPGVVSCADILAFAARDSAMVSGGFTFPMPGGRRDGLTSDLSDIPASLPGPNMQVQDLIKSFGAKGLSAVDLVALSGAHSFGETHCSFVTPRLYPTLDKTMDRAFGVALQTVxxxxxxxxTPLDNNRVTDPNVLSNQYYKNVIAGQVMFTSDQTLRSDASTAKMVQDNADNPVAWMARFAAAMVNMGGIEVLTGTQGEIRKVCGATNSGS

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from phytozome (Undetermined residues in frame due to NNNN in DNA).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGACCTCAGCATGCCAGGCCTTGCTGCTCATGGCGTTGGCTGCTGCTGTGCTGAGCACGGCGTCTGGGACATTGAAGTACGACTTCTACAGCTTGTCGTGCCCCAAAGCCGAGGAG
GCGGTCCGCAACGCCACCATGAAGATCATCTCAGATAAACCTTCCATGGGCGCCGCCTTTGTGCGCCTCTACTTCCATGACTGCTTTGTCAAG
GTAATAAACATTGATACGATCATCTTC
ACGTCTCATGGTCGGTGTCGTTAAACTGTCGAAAGTTTTCCAATGTAATAGTATATTTTGGGCTTGTCTATTCCATACTCGAGTGTTTTGGGAGGACATGGCGCTCGAGTGCAGAGTTCC
CCCCAAACACCCGATTTTCTTTGTCGGGGCAATCGAGTGTTTTGGGTTGATTTGGATCCATTGGCTACAAATAAAACCTGCTTTAGTGTTACAGATTAACAATAAAAAACAGATATTTAC
AGATTACACTCGAGCGCTGTATGGATTAATGTTCGTATATTTTCGGTGTAAACAAACTGTACCACTTTTCTAGCTATTTGATGACTTATGGTCTGTGTCGTTTAACACACGCGATGTGAT
TTTTCAGGGTTGCGACGCTTCCATTCTGCTGAACCAGTCGAACAGCAACCCGCAGCCGGAGAAGCTGGGCATCCCGCTCCGCGGCTACGACGAAGTGAACACGATCAAGGCGGCCGTGGA
GGCCGTCTGCCCCGGCGTGGTCTCCTGCGCCGACATCCTCGCCTTCGCGGCGCGAGACTCCGCCATGGTCTCCGGCGGCTTCACCTTCCCCATGCCGGGCGGCCGCCGCGACGGGCTCAC
CTCCGACCTGAGCGACATTCCGGCGAGCCTCCCTGGTCCTAACATGCAGGTCCAGGACCTCATCAAGAGCTTCGGCGCCAAGGGCCTGAGCGCCGTCGACCTGGTGGCGCTCTCCGGCGC
GCACTCCTTCGGCGAGACCCACTGCTCCTTCGTCACGCCCCGGCTGTACCCGACCCTGGACAAGACCATGGACAGGGCCTTCGGCGTGGCGCTGCAGACGGTTTNNNNNNNNNNNNNNNN
NNNNNNNACGCCGCTGGACAACAACCGCGTGACGGACCCGAACGTTCTGAGCAACCAGTACTACAAGAACGTGATCGCCGGGCAGGTGATGTTCACGTCGGACCAGACGCTGAGGAGCGA
CGCGTCCACGGCCAAGATGGTGCAGGACAACGCCGACAACCCTGTCGCGTGGATGGCGCGGTTCGCGGCGGCGATGGTGAATATGGGCGGCATCGAGGTGCTCACCGGGACCCAGGGCGA
GATCAGGAAGGTGTGCGGCGCCACCAACAGCGGGAGC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGACCTCAGCATGCCAGGCCTTGCTGCTCATGGCGTTGGCTGCTGCTGTGCTGAGCACGGCGTCTGGGACATTGAAGTACGACTTCTACAGCTTGTCGTGCCCCAAAGCCGAGGAG
GCGGTCCGCAACGCCACCATGAAGATCATCTCAGATAAACCTTCCATGGGCGCCGCCTTTGTGCGCCTCTACTTCCATGACTGCTTTGTCAAG
GGTTGCGACGCTTCCATTCTGCTGAAC
CAGTCGAACAGCAACCCGCAGCCGGAGAAGCTGGGCATCCCGCTCCGCGGCTACGACGAAGTGAACACGATCAAGGCGGCCGTGGAGGCCGTCTGCCCCGGCGTGGTCTCCTGCGCCGAC
ATCCTCGCCTTCGCGGCGCGAGACTCCGCCATGGTCTCCGGCGGCTTCACCTTCCCCATGCCGGGCGGCCGCCGCGACGGGCTCACCTCCGACCTGAGCGACATTCCGGCGAGCCTCCCT
GGTCCTAACATGCAGGTCCAGGACCTCATCAAGAGCTTCGGCGCCAAGGGCCTGAGCGCCGTCGACCTGGTGGCGCTCTCCGGCGCGCACTCCTTCGGCGAGACCCACTGCTCCTTCGTC
ACGCCCCGGCTGTACCCGACCCTGGACAAGACCATGGACAGGGCCTTCGGCGTGGCGCTGCAGACGGTTTNNNNNNNNNNNNNNNNNNNNNNNACGCCGCTGGACAACAACCGCGTGACG
GACCCGAACGTTCTGAGCAACCAGTACTACAAGAACGTGATCGCCGGGCAGGTGATGTTCACGTCGGACCAGACGCTGAGGAGCGACGCGTCCACGGCCAAGATGGTGCAGGACAACGCC
GACAACCCTGTCGCGTGGATGGCGCGGTTCGCGGCGGCGATGGTGAATATGGGCGGCATCGAGGTGCTCACCGGGACCCAGGGCGAGATCAGGAAGGTGTGCGGCGCCACCAACAGCGGG
AGC

Retrieve as FASTA