Entry information : SiPrx[P]103 (Si024400m)
Entry ID 9591
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-12-12 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2011-12-07 (Qiang Li)
Peroxidase information: SiPrx[P]103 (Si024400m)
Name (synonym) SiPrx[P]103 (Si024400m)
Class Class III peroxidase     [Orthogroup: Prx030]*
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx[P]103
start..stop
S start..stop
SiPrx68 281 8.11e-94 1..225 1..213
SiPrx68 110 4.81e-28 243..312 297..359
SiPrx[P]179 246 4.39e-83 140..287 1..148
SbPrx103 250 1.86e-81 1..225 1..212
SbPrx103 90 1.13e-20 243..311 302..371
ZmPrx32 236 6.17e-76 1..225 1..210
ZmPrx32 97 3.92e-23 243..311 300..368
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '9591' 'complement(join(11033251..11033654,11033728..11033909,11034014..11034230))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 11034014..11034230 215 N° 2 11033728..11033909 180 N° 3 11033251..11033654 402  
complement(join(11033251..11033654,11033728..11033909,11034014..11034230))


exon

Literature and cross-references SiPrx[P]103 (Si024400m)
DNA ref. Phytozome 12:   scaffold_3 (11034230..11033251)
Protein sequence: SiPrx[P]103 (Si024400m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   312 (281)
PWM (Da):   %s   32459.62 (29351.0) Transmb domain:   %s   i12-34o
PI (pH):   %s   8.5 (8.51) Peptide Signal:   %s   cut: 32 range:32-312
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAYSTTTVALQVVALLLTLTIAASTATTGSAAPVNTSCVTGSAGATVSIGYSGARASAGAGVSLGAGVYRATCPRAEEIVRAAVERAVAADPRMAASIIRLHLHDCFVNVRCLFARLDPG
LRRLRAPGRQAALLHRREDANSLRDFEVIDAIKAELERECPETVSCADLLAIAARDSVVVSGGPSWEVEAGRKDGRTASLQGANVNLPAPTSGVATLRAEVQERRPLRQGHGRPLRRAHH
RQVTPSDQAPSGAAVPGAEDDDGVAGLVAAYAFDASVFFQDFAESMLRMGRRAPGGGGGEVRTNCRVVNSSS*

Retrieve as FASTA  
Remarks Pseudogene from genomic. Incorrect prediction from phytozome (Gaps in frame).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCATTGGTTATAGCGGGGCGAGGGCCAGCGCCGGCGCCGGCGTTTCTCTCGGTGCCGGCGTGTACCGCGCCACCTGCCCCCGCGCCGAGGAGATCGTCCGCGCCGCCGTCGAGAGGGCCG
TCGCCGCCGACCCGCGCATGGCGGCGTCCATCATCCGCCTCCATTTACACGACTGCTTCGTCAACGTACGCTGTTTGTTCGCCCGGCTGGATCCAGG
TCCGATCATTGACACGTAGTACG
TGTCTAGATGCAACAATGGTGTGTGTGTCCTGCAAGCTGCAATGCGGTGATAGTTCATTCGTTTCTCCTTTTCTCATCAGGGCGCTGCGACGGCTCCGTGCTCCTGGACGACAAGCCGCC
CTTCTTCATCGGCGAGAAGACGCCAACTCGCTCAGGGACTTCGAGGTCATCGACGCCATCAAGGCTGAGCTGGAGCGAGAGTGCCCGGAGACAGTCTCCTGCGCCGACCTCCTCGCCATC
GCTGCCCGTGACTCCGTCGTGGTGG
TAATAATCACATACATGCATGCAATTATCAACCACAAGCATCTAGATGATCACTGATCGCCGGTGCATTCAGTCGCGGGCGGGCCGAGCTGGGAG
GTAGAGGCCGGCCGGAAGGACGGCCGCACGGCGAGCCTTCAGGGCGCCAACGTCAACCTCCCGGCGCCGACGTCCGGCGTCGCTACCCTTCGTGCAGAAGTTCAGGAACGTCGGCCTCTC
CGCCAAGGACATGGTCGCCCTCTCAGGCGCGCACACCATCGGCAAGTCACGGTGTGCAGNCCGTCCGACCAGGCGCCGTCAGGCGCAGCCGTGCCCGGGGCAGAGGACGACGACGGAGTC
GCCGGCCTTGTGGCCGCCTACGCGTTCGACGCCTCCGTCTTCTTCCAGGACTTTGCGGAGTCCATGCTGCGTATGGGGAGGCGCGCGCCAGGCGGCGGCGGCGGCGAGGTCCGCACGAAC
TGCCGGGTGGTGAACAGCTCGAGC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCATTGGTTATAGCGGGGCGAGGGCCAGCGCCGGCGCCGGCGTTTCTCTCGGTGCCGGCGTGTACCGCGCCACCTGCCCCCGCGCCGAGGAGATCGTCCGCGCCGCCGTCGAGAGGGCCG
TCGCCGCCGACCCGCGCATGGCGGCGTCCATCATCCGCCTCCATTTACACGACTGCTTCGTCAACGTACGCTGTTTGTTCGCCCGGCTGGATCCAGG
GCTGCGACGGCTCCGTGCTCCTG
GACGACAAGCCGCCCTTCTTCATCGGCGAGAAGACGCCAACTCGCTCAGGGACTTCGAGGTCATCGACGCCATCAAGGCTGAGCTGGAGCGAGAGTGCCCGGAGACAGTCTCCTGCGCCG
ACCTCCTCGCCATCGCTGCCCGTGACTCCGTCGTGGTGG
CGGGCGGGCCGAGCTGGGAGGTAGAGGCCGGCCGGAAGGACGGCCGCACGGCGAGCCTTCAGGGCGCCAACGTCAACCTCC
CGGCGCCGACGTCCGGCGTCGCTACCCTTCGTGCAGAAGTTCAGGAACGTCGGCCTCTCCGCCAAGGACATGGTCGCCCTCTCAGGCGCGCACACCATCGGCAAGTCACGGTGTGCAGNC
CGTCCGACCAGGCGCCGTCAGGCGCAGCCGTGCCCGGGGCAGAGGACGACGACGGAGTCGCCGGCCTTGTGGCCGCCTACGCGTTCGACGCCTCCGTCTTCTTCCAGGACTTTGCGGAGT
CCATGCTGCGTATGGGGAGGCGCGCGCCAGGCGGCGGCGGCGGCGAGGTCCGCACGAACTGCCGGGTGGTGAACAGCTCGAGC

Retrieve as FASTA