Entry information : TvLiP04 (LiP4)
Entry ID 9596
Creation 2011-10-05 (Christophe Dunand)
Last sequence changes 2011-10-05 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-03-27 (Catherine Mathe (Scipio))
Peroxidase information: TvLiP04 (LiP4)
Name (synonym) TvLiP04 (LiP4)
Class Lignin peroxidase    [Orthogroup: LiP002]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Coriolaceae Trametes
Organism Trametes versicolor (Coriolus versicolor )    [TaxId: 5325 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TvLiP04
start..stop
S start..stop
TvLiP 701 0 1..364 1..370
TvLiP03 688 0 1..364 1..364
TvLiP10 685 0 1..364 1..364
TvLiP06 638 0 1..359 1..359
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 183176..183236 61 N° 2 182778..183120 343 N° 3 182180..182726 547 N° 4 182051..182125 75
N° 5 181929..181997 69  
complement(join(181929..181997,182051..182125,182180..182726,182778..183120,1831 76..183236))


exon

Literature and cross-references TvLiP04 (LiP4)
DNA ref. JGI genome:   scaffold_12 (183236..181929)
Protein sequence: TvLiP04 (LiP4)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   364 (343)
PWM (Da):   %s   38671.14 (36609.0)  
PI (pH):   %s   4.5 (4.44) Peptide Signal:   %s   cut: 22 range:22-364
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTFKGLLTAVSIAATLTGTNAALTRRVSCPDGVNTATNAACCQLFAVRQDLQQNLFHGGLCTAEAHESLRLTFHDAIAISPALEAQGKFGGGGADGSISIFPEIETKFHPNVGLDEIVALQKPLQARHNLSHADFLHFAGALAASNCAGAPQLSAFVGRKDATQPAPDGLVPEPFHTPDQIFDRLADASEGEFDPILTVWLLTAHTVAAANDVDPTKSGLPFDSTPEIWDTQFFVETQLRGTLFPGKGGNQGEVESPLAGEIRLQSDHTIARDTRTACEWQSFVDNQPKAQQMFQFVFQVLTTLGQNQDDLVDCTEVPIPAPPQGHTHLPAGMTMNDIEQACAETPFPTLPADPGPRTAVAPV*

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTTTCAAGGGTCTCCTCACAGCTGTCTCCATCGCCGCCACCCTCACGGGCACCAACGGTACGTGCTTCATGCATTATGCACACGCAACTTGCTAATGTCGCTTCTCTACCAGCCGC
GCTGACGCGCCGCGTGTCCTGCCCCGATGGCGTCAACACCGCGACGAACGCCGCATGTTGCCAGCTCTTCGCCGTCCGTCAGGACCTCCAGCAGAACCTCTTCCACGGCGGTCTGTGCAC
GGCCGAGGCACACGAGTCGCTCCGCCTGACGTTCCACGACGCGATCGCGATCTCGCCCGCGCTGGAGGCGCAAGGCAAGTTCGGCGGTGGAGGGGCGGACGGCTCGATTTCGATCTTCCC
TGAGATCGAGACCAAGTTCCACCCCAACGTCGGACTCGACGAGATTGTCGCCCTCCAGAAGCCGCTTCAGGCGCGCCACAACCTGTCGCACGCTGACTT
GTACGTCCCACATTCGTCGTA
TACACTTCGCTTTCACTGACACTCCCCCAGCTTGCACTTCGCTGGTGCGCTCGCTGCGTCTAACTGCGCCGGCGCTCCCCAGCTATCCGCATTCGTCGGCCGCAAGGACGCTACCCAACC
CGCACCCGACGGTCTCGTTCCCGAACCGTTCCACACCCCCGACCAGATCTTTGACCGTCTCGCCGACGCCTCCGAGGGCGAGTTCGACCCCATCCTCACCGTCTGGCTCCTGACCGCGCA
CACCGTGGCCGCTGCCAACGACGTCGACCCGACCAAGTCTGGGCTGCCGTTCGACTCGACGCCCGAGATTTGGGACACGCAATTCTTCGTGGAGACACAGCTGCGCGGGACACTGTTCCC
GGGCAAGGGCGGGAACCAGGGCGAGGTGGAGAGCCCGCTTGCTGGGGAGATTCGCCTGCAGAGCGACCACACGATTGCGCGGGACACACGGACGGCGTGCGAGTGGCAGTCGTTTGTGGA
CAACCAGCCGAAAGCACAGCAGATGTTCCAGTTTGTGTTCCAGGTGTTGACGACGCTTGGGCAGAACCAGGACGACCTTGTCGACTGCACCGAAGTC
GTACGTCTCGCGTGACCTTCAAC
CTTTCTATCACGATGCTGACTTCGCTTGCAGGTCCCGATCCCCGCGCCGCCTCAAGGCCATACTCACCTCCCCGCCGGAATGACAATGAACGATATTGAGCAGGCGGTATGTATGAGTCA
TGGCTCGTCTTTGTATCATACTCACTATTTTATGCACAGTGCGCCGAGACTCCGTTCCCCACCCTCCCGGCTGACCCCGGTCCGCGCACCGCTGTCGCCCCCGTGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTTTCAAGGGTCTCCTCACAGCTGTCTCCATCGCCGCCACCCTCACGGGCACCAACGCCGCGCTGACGCGCCGCGTGTCCTGCCCCGATGGCGTCAACACCGCGACGAACGCCGCA
TGTTGCCAGCTCTTCGCCGTCCGTCAGGACCTCCAGCAGAACCTCTTCCACGGCGGTCTGTGCACGGCCGAGGCACACGAGTCGCTCCGCCTGACGTTCCACGACGCGATCGCGATCTCG
CCCGCGCTGGAGGCGCAAGGCAAGTTCGGCGGTGGAGGGGCGGACGGCTCGATTTCGATCTTCCCTGAGATCGAGACCAAGTTCCACCCCAACGTCGGACTCGACGAGATTGTCGCCCTC
CAGAAGCCGCTTCAGGCGCGCCACAACCTGTCGCACGCTGACTT
CTTGCACTTCGCTGGTGCGCTCGCTGCGTCTAACTGCGCCGGCGCTCCCCAGCTATCCGCATTCGTCGGCCGCAAG
GACGCTACCCAACCCGCACCCGACGGTCTCGTTCCCGAACCGTTCCACACCCCCGACCAGATCTTTGACCGTCTCGCCGACGCCTCCGAGGGCGAGTTCGACCCCATCCTCACCGTCTGG
CTCCTGACCGCGCACACCGTGGCCGCTGCCAACGACGTCGACCCGACCAAGTCTGGGCTGCCGTTCGACTCGACGCCCGAGATTTGGGACACGCAATTCTTCGTGGAGACACAGCTGCGC
GGGACACTGTTCCCGGGCAAGGGCGGGAACCAGGGCGAGGTGGAGAGCCCGCTTGCTGGGGAGATTCGCCTGCAGAGCGACCACACGATTGCGCGGGACACACGGACGGCGTGCGAGTGG
CAGTCGTTTGTGGACAACCAGCCGAAAGCACAGCAGATGTTCCAGTTTGTGTTCCAGGTGTTGACGACGCTTGGGCAGAACCAGGACGACCTTGTCGACTGCACCGAAGTC
GTCCCGATC
CCCGCGCCGCCTCAAGGCCATACTCACCTCCCCGCCGGAATGACAATGAACGATATTGAGCAGGCG
TGCGCCGAGACTCCGTTCCCCACCCTCCCGGCTGACCCCGGTCCGCGCACCGCT
GTCGCCCCCGTGTAA

Retrieve as FASTA