Entry information : TvLiP02 (LiP2)
Entry ID 9597
Creation 2011-10-05 (Christophe Dunand)
Last sequence changes 2012-03-28 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-10-05 (Christophe Dunand)
Peroxidase information: TvLiP02 (LiP2)
Name (synonym) TvLiP02 (LiP2)
Class Lignin peroxidase    [Orthogroup: LiP002]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Coriolaceae Trametes
Organism Trametes versicolor (Coriolus versicolor )    [TaxId: 5325 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TvLiP02
start..stop
S start..stop
TvLiP02_PRL572 735 0 1..367 1..367
TvLiP12_PRL572 618 0 1..367 1..367
TvLiP12 618 0 1..367 1..367
TvLiP08 597 0 1..364 1..364
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2752329..2752389 61 N° 2 2752458..2752665 208 N° 3 2752726..2752860 135 N° 4 2752916..2753462 547
N° 5 2753519..2753593 75 N° 6 2753655..2753719 65 N° 7 2753779..2753791 13  
join(2752329..2752389,2752458..2752665,2752726..2752860,2752916..2753462,2753519 ..2753593,2753655..2753719,2753779..2753791)


exon

Literature and cross-references TvLiP02 (LiP2)
DNA ref. JGI genome:   scaffold_2 (2752329..2753791)
Protein sequence: TvLiP02 (LiP2)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   367
PWM (Da):   %s   38688.16  
PI (pH):   %s   3.99
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFKTLLSIVSLLAAFQGATAALTRRVACPDGVNTATNAACCQLFAVRDDLQENLFHGGLCTAEAHESLRLTFHDAIAISPALEQQGIFGGGGADGSIAIFSDIETAFHPNIGLDEIVELQKPFIARHNLSVADFIQFAGAIGASNCAGAPQLAAFVGRVDATQPAPDGLVPEPFHTPDQIFARLADASQGEFDEILTVWLLVAHTVAAANDVDPTVPGSPFDSTPEVWDTQFFVEVLLNGTTFPGTGDNQGEVASPIAGEFRLQSDFAIARDSRSACEWQSFVDNQPKAQAMFQFVFHDLSIFGQDINSLVDCTEVPIPAPLQGVTHFPAGLTVNDIDQPCVETPFPTLPTDPGPATSVAPVPLP

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCAAAACCTTACTCTCCATCGTCTCCCTTTTGGCGGCGTTCCAGGGCGCGACCGGTACGTGGCTAGCGCGGCCGACGTCGACATCATTTGTCACGACAATCTGACGTCTTTTC
ATCCGCTAGCCGCATTGACCCGCCGCGTCGCTTGCCCCGACGGAGTGAACACCGCGACTAACGCGGCGTGCTGCCAGCTCTTCGCTGTGCGCGACGACCTCCAGGAGAACCTTTTCCACG
GCGGTCTCTGCACGGCCGAGGCGCACGAGTCTCTTCGCCTGACGTTCCACGACGCCATCGCCATCTCCCCTGCTCTTGAGCAGCAGGGTATCTTTGG
GTATGTCTAGCACGTTGTAAGCA
TTCAAGACATCGTTATTGATGATACTCTACTGCACAGTGGCGGAGGTGCCGATGGGTCCATCGCGATCTTCTCCGACATCGAGACCGCCTTCCACCCCAACATCGGTCTTGACGAGATCG
TCGAGCTCCAGAAGCCGTTCATCGCGCGTCACAACCTCTCCGTCGCTGACTT
GTAAGCTCCACTGTTGATGATGCGACTATAACAACATGCTAACTCGTCGCTATAGTATTCAATTCGCC
GGAGCCATCGGTGCCTCGAACTGCGCGGGTGCTCCCCAACTTGCCGCCTTCGTCGGCCGCGTGGATGCTACTCAGCCCGCCCCCGACGGTCTCGTCCCCGAGCCATTCCACACCCCGGAC
CAGATCTTCGCCCGCCTCGCCGACGCGTCCCAGGGCGAGTTCGACGAGATCTTGACTGTGTGGCTCCTCGTCGCCCACACCGTCGCCGCGGCGAACGACGTCGACCCGACCGTCCCCGGC
TCGCCCTTCGACTCGACCCCGGAGGTCTGGGACACGCAGTTCTTCGTCGAGGTCCTTCTGAACGGCACGACCTTCCCCGGCACCGGCGACAACCAGGGTGAGGTCGCGTCCCCGATCGCC
GGCGAGTTCCGCCTGCAGTCCGACTTCGCGATCGCGCGCGACAGCCGCTCCGCGTGCGAGTGGCAGTCGTTCGTCGACAACCAGCCCAAGGCGCAGGCAATGTTCCAGTTCGTGTTCCAC
GACCTTTCCATCTTCGGCCAGGACATCAACTCGCTCGTCGACTGCACGGAAGTT
GTGCGTGCTTCTGCTCCTATAGAACGTTTTAGACACCGACTAACCGACAAGCATAGGTTCCGATTC
CGGCACCGCTCCAGGGCGTGACCCACTTCCCCGCTGGTTTGACCGTCAACGACATCGACCAGCCT
GTACGTATTTCTGATACAGCCCTAGCTTGTTGCAGTACTGATCACCAGCTATCTC
GGACAGTGCGTCGAGACCCCCTTCCCCACTCTCCCGACTGACCCCGGTCCCGCGACCTCTGTCGCCCCCGTGTAAGTTTTCAGCTATGATCGATATGATTAGTCACTTACTACAGCCTTT
TGTTTCATAGCCCCCTTCCGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCAAAACCTTACTCTCCATCGTCTCCCTTTTGGCGGCGTTCCAGGGCGCGACCGCCGCATTGACCCGCCGCGTCGCTTGCCCCGACGGAGTGAACACCGCGACTAACGCGGCG
TGCTGCCAGCTCTTCGCTGTGCGCGACGACCTCCAGGAGAACCTTTTCCACGGCGGTCTCTGCACGGCCGAGGCGCACGAGTCTCTTCGCCTGACGTTCCACGACGCCATCGCCATCTCC
CCTGCTCTTGAGCAGCAGGGTATCTTTGG
TGGCGGAGGTGCCGATGGGTCCATCGCGATCTTCTCCGACATCGAGACCGCCTTCCACCCCAACATCGGTCTTGACGAGATCGTCGAGCTC
CAGAAGCCGTTCATCGCGCGTCACAACCTCTCCGTCGCTGACTT
TATTCAATTCGCCGGAGCCATCGGTGCCTCGAACTGCGCGGGTGCTCCCCAACTTGCCGCCTTCGTCGGCCGCGTG
GATGCTACTCAGCCCGCCCCCGACGGTCTCGTCCCCGAGCCATTCCACACCCCGGACCAGATCTTCGCCCGCCTCGCCGACGCGTCCCAGGGCGAGTTCGACGAGATCTTGACTGTGTGG
CTCCTCGTCGCCCACACCGTCGCCGCGGCGAACGACGTCGACCCGACCGTCCCCGGCTCGCCCTTCGACTCGACCCCGGAGGTCTGGGACACGCAGTTCTTCGTCGAGGTCCTTCTGAAC
GGCACGACCTTCCCCGGCACCGGCGACAACCAGGGTGAGGTCGCGTCCCCGATCGCCGGCGAGTTCCGCCTGCAGTCCGACTTCGCGATCGCGCGCGACAGCCGCTCCGCGTGCGAGTGG
CAGTCGTTCGTCGACAACCAGCCCAAGGCGCAGGCAATGTTCCAGTTCGTGTTCCACGACCTTTCCATCTTCGGCCAGGACATCAACTCGCTCGTCGACTGCACGGAAGTT
GTTCCGATT
CCGGCACCGCTCCAGGGCGTGACCCACTTCCCCGCTGGTTTGACCGTCAACGACATCGACCAGCCT
TGCGTCGAGACCCCCTTCCCCACTCTCCCGACTGACCCCGGTCCCGCGACCTCT
GTCGCCCCCGT
CCCCCTTCCGTGA

Retrieve as FASTA