Entry information : TvLiP
Entry ID 9600
Creation 2011-10-05 (Christophe Dunand)
Last sequence changes 2012-10-29 (Nizar Fawal)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-15 (Christophe Dunand)
Peroxidase information: TvLiP
Name TvLiP
Class Lignin peroxidase    [Orthogroup: LiP002]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Coriolaceae Trametes
Organism Trametes versicolor (Coriolus versicolor )    [TaxId: 5325 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TvLiP
start..stop
S start..stop
TvLiP04 701 0 1..370 1..364
TvLiP03 682 0 1..370 1..364
TvLiP10 680 0 1..370 1..364
TvLiP06 635 0 1..365 1..359
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 185711..185771 61 N° 2 185809..186169 361 N° 3 186221..186767 547 N° 4 186818..186892 75
N° 5 186946..187014 69  
join(185711..185771,185809..186169,186221..186767,186818..186892,186946..187014)


exon

Literature and cross-references TvLiP
DNA ref. JGI genome:   scaffold_12 (185711..187014)
Protein sequence: TvLiP
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   370
PWM (Da):   %s   39243.32  
PI (pH):   %s   4.55
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFKSLLTAVSLAAALTGTNGMCSAHSALTRRVSCPDGVNTATNAACCQLFAVRQDLQQNLFHGGLCTAEAHESLRLTFHDAIAISPALEAQGKFGGGGADGSISIFPEIETKFHPNVGLDEIVALQKPLQARHNLSHADFLHFAGALAASNCAGAPQLSAFVGRKDATQPAPDGLVPEPFHTPDQIFDRLADASEGEFDPILTVWLLTAHTVAAANDVDPTKSGLPFDSTPEIWDTQFFVETQLRGTLFPGKGGNQGEVESPLAGEIRLQSDHTIARDTRTACEWQSFVDNQPKAQQMFQFVFQVLTTLGQNQDDLVDCTEVVPIPAPPQGHTHLPAGMTMNDIEQACAETPFPTLPADPGPRTAVAPV

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCAAGAGTCTCCTCACCGCCGTCTCCCTCGCCGCCGCCCTCACTGGCACCAACGGCATGTGCTCTGCGCATTGTACGCATACATTTTGCTGATGCCTCTTTTCCACCAGCCGC
GTTGACGCGCCGCGTGTCCTGCCCCGACGGCGTCAACACCGCGACGAACGCTGCATGCTGCCAGCTGTTCGCCGTCCGTCAGGACTTGCAGCAGAACCTCTTCCACGGTGGTCTGTGCAC
GGCCGAGGCGCACGAGTCGCTCCGGCTGACATTCCACGACGCGATCGCGATCTCGCCCGCGCTGGAGGCGCAAGGCAAGTTCGGTGGTGGAGGCGCAGACGGCTCCATTTCGATCTTCCC
CGAGATCGAGACGAAGTTCCACCCTAACGTCGGTCTCGACGAGATCGTCGCGCTCCAGAAGCCGCTTCAAGCGCGCCACAACTTGTCGCACGCCGACTT
GTAAGTCCGTTTCGTATTCGC
GCCCATATACCGATGTTGAGAATCCTCCAGCTTGCACTTTGCCGGCGCCCTTGCTGCATCGAACTGCGCCGGCGCGCCACAGCTATCCGCATTCGTCGGCCGCAAGGACGCCACCCAGCC
CGCACCCGATGGCCTCGTCCCCGAACCGTTCCACACCCCCGACCAGATCTTCGACCGTCTCGCCGACGCGTCCGAGGGCGAGTTCGACCCCATCCTCACCGTCTGGCTCCTCACCGCGCA
CACTGTGGCCGCCGCCAACGACGTCGACCCGACGAAGTCGGGACTGCCGTTCGACTCGACCCCCGAGATCTGGGACACGCAATTCTTCGTGGAGACGCAGCTGCGCGGGACGCTGTTCCC
GGGCAAGGGCGGGAACCAGGGCGAGGTGGAGAGCCCGCTTGCTGGGGAGATTCGCCTGCAGAGCGACCACACGATTGCGCGGGACACGCGGACGGCGTGCGAGTGGCAGTCGTTTGTGGA
CAACCAGCCGAAGGCGCAGCAGATGTTCCAGTTTGTGTTCCAGGTGTTGACCACTCTCGGGCAGAACCAGGACGACCTCGTTGACTGCACTGAAGTC
GTACGTCGTTCTGCGTTCACTTT
ACCGTTGATATGCTCACTCGTTTCCAGGTTCCGATCCCCGCGCCGCCGCAGGGCCACACTCACCTCCCTGCCGGCATGACCATGAACGACATCGAGCAGGCGGTAGGCACGCTCCATGTA
TTGTCTTCGATTCGCACTCATTGTTCTCCGCACAGTGCGCCGAGACTCCCTTCCCCACTCTCCCGGCCGATCCTGGACCCCGCACCGCTGTCGCCCCCGTGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCAAGAGTCTCCTCACCGCCGTCTCCCTCGCCGCCGCCCTCACTGGCACCAACGATGCCTCTTTTCCACCAGCCGCGTTGACGCGCCGCGTGTCCTGCCCCGACGGCGTCAAC
ACCGCGACGAACGCTGCATGCTGCCAGCTGTTCGCCGTCCGTCAGGACTTGCAGCAGAACCTCTTCCACGGTGGTCTGTGCACGGCCGAGGCGCACGAGTCGCTCCGGCTGACATTCCAC
GACGCGATCGCGATCTCGCCCGCGCTGGAGGCGCAAGGCAAGTTCGGTGGTGGAGGCGCAGACGGCTCCATTTCGATCTTCCCCGAGATCGAGACGAAGTTCCACCCTAACGTCGGTCTC
GACGAGATCGTCGCGCTCCAGAAGCCGCTTCAAGCGCGCCACAACTTGTCGCACGCCGACTT
CTTGCACTTTGCCGGCGCCCTTGCTGCATCGAACTGCGCCGGCGCGCCACAGCTATCC
GCATTCGTCGGCCGCAAGGACGCCACCCAGCCCGCACCCGATGGCCTCGTCCCCGAACCGTTCCACACCCCCGACCAGATCTTCGACCGTCTCGCCGACGCGTCCGAGGGCGAGTTCGAC
CCCATCCTCACCGTCTGGCTCCTCACCGCGCACACTGTGGCCGCCGCCAACGACGTCGACCCGACGAAGTCGGGACTGCCGTTCGACTCGACCCCCGAGATCTGGGACACGCAATTCTTC
GTGGAGACGCAGCTGCGCGGGACGCTGTTCCCGGGCAAGGGCGGGAACCAGGGCGAGGTGGAGAGCCCGCTTGCTGGGGAGATTCGCCTGCAGAGCGACCACACGATTGCGCGGGACACG
CGGACGGCGTGCGAGTGGCAGTCGTTTGTGGACAACCAGCCGAAGGCGCAGCAGATGTTCCAGTTTGTGTTCCAGGTGTTGACCACTCTCGGGCAGAACCAGGACGACCTCGTTGACTGC
ACTGAAGTC
GTTCCGATCCCCGCGCCGCCGCAGGGCCACACTCACCTCCCTGCCGGCATGACCATGAACGACATCGAGCAGGCGTGCGCCGAGACTCCCTTCCCCACTCTCCCGGCCGAT
CCTGGACCCCGCACCGCTGTCGCCCCCGTGTAA

Retrieve as FASTA