Entry information : TvLiP09 (LiP9)
Entry ID 9602
Creation 2011-10-05 (Christophe Dunand)
Last sequence changes 2011-10-05 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-03-27 (Catherine Mathe (Scipio))
Peroxidase information: TvLiP09 (LiP9)
Name (synonym) TvLiP09 (LiP9)
Class Lignin peroxidase    [Orthogroup: LiP002]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Coriolaceae Trametes
Organism Trametes versicolor (Coriolus versicolor )    [TaxId: 5325 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TvLiP09
start..stop
S start..stop
TvLiP01 593 0 1..361 1..365
TvLiP02_PRL572 556 0 1..361 1..364
TvLiP02 556 0 1..361 1..364
TvLiP12_PRL572 548 0 6..361 3..364
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 953561..953618 58 N° 2 953668..953869 202 N° 3 953935..954069 135 N° 4 954129..954675 547
N° 5 954734..954808 75 N° 6 954861..954929 69  
join(953561..953618,953668..953869,953935..954069,954129..954675,954734..954808, 954861..954929)


exon

Literature and cross-references TvLiP09 (LiP9)
DNA ref. JGI genome:   scaffold_12 (953561..954929)
Protein sequence: TvLiP09 (LiP9)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   361 (341)
PWM (Da):   %s   38743.29 (36736.2)  
PI (pH):   %s   4.76 (4.68) Peptide Signal:   %s   cut: 21 range:21-361
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVSKFFTSLVSLAAVLGANASLTRRVACPDGRHTATNAACCALFPLRDDLQANLFDGGKCNAEAHESLRLTFHDAIAISPALEAQGNGGGADGSITIFSHIETGFHPNIGLDEVVEKQRPFLQRHNIGVADFIQFAGALGASNCAGAPQLSAFVGRKDATRPAPDGLVPEPFHTPDQIFARIADASSGEFDEILTVWLLTAHTIAAANDVDPTVPGSPFDSTPEIFDSQFFLETQLKGTAFTGRGPVQGEVTSPLRGEFRLQSDFAIARDQRTACEWQSFVNNQTKVQQMFQFVFHDLSILGQNIDDLVDCTEIPIPRPLTTRTHFPAGMTHRDIEQACLETPFPTLPTDPGPRTGVAPV*

Retrieve as FASTA  
Remarks Complete sequence from genomic (5 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTTCCAAGTTCTTCACCTCCCTCGTCTCCCTCGCTGCTGTCCTGGGTGCTAACGGTACGTGGACGTTGTTTAAATCGTAGTCGCCTAGCTGATTCTGTTATAGCTTCCCTGACGCG
CCGTGTTGCGTGCCCCGACGGCAGGCACACCGCTACCAACGCGGCTTGCTGCGCTCTCTTCCCTCTCCGGGACGATCTCCAGGCCAACCTCTTCGACGGCGGCAAGTGCAACGCTGAGGC
GCACGAGTCTCTCCGCTTGACGTTCCACGACGCCATCGCCATCTCGCCGGCCCTGGAGGCGCAGGGCAA
GTTCGGGTTAGTGGCATACGCAATGCATTGCAGATCATCATTACTCACTAG
ACTACGCATTACAGCGGTGGAGGTGCCGACGGCTCCATCACGATCTTTTCGCACATCGAGACGGGCTTCCACCCCAACATCGGTCTCGACGAGGTTGTCGAGAAGCAGCGGCCTTTCCTC
CAGCGCCACAACATCGGTGTTGCTGACTT
GTGAGTTGCACAGCACGCCCCAGGGTTTTCACGGGCTCCCGCTCATGCTTCGTTCACAGCATTCAATTCGCCGGTGCCCTCGGTGCGTCCA
ACTGCGCAGGTGCTCCCCAGCTCAGCGCCTTCGTCGGCCGCAAGGACGCGACTCGCCCCGCCCCCGACGGTCTCGTCCCGGAGCCGTTCCACACGCCCGACCAGATCTTCGCCCGCATCG
CCGACGCGTCCTCGGGCGAGTTCGACGAGATCCTGACCGTCTGGCTGCTCACCGCGCACACGATCGCCGCCGCCAACGACGTCGACCCGACCGTGCCCGGCTCGCCGTTCGACTCCACCC
CCGAGATCTTCGACTCGCAGTTCTTCCTCGAGACGCAGCTCAAGGGCACCGCCTTCACCGGGCGCGGCCCCGTCCAGGGCGAGGTCACGTCCCCGCTGCGCGGCGAGTTCCGCCTGCAGT
CCGACTTCGCGATCGCGCGCGACCAGCGCACCGCGTGCGAGTGGCAGTCGTTCGTCAACAACCAGACTAAGGTCCAGCAGATGTTCCAGTTCGTCTTCCACGACCTCTCCATCCTCGGCC
AGAACATCGACGACCTCGTTGACTGCACGGAAGTG
GTGAGTATATAGCTCTTGTCAGAAGATGCTCGATGATCTGACCTGTTCTCGCCCGCAGATCCCGATCCCCAGGCCCCTCACCACC
AGGACCCACTTCCCCGCCGGCATGACCCACCGCGACATCGAGCAGGCT
GTGAGTCATTCATTTCCATTTAGACACTTGCCGTGCTCACACATCCTATCAGTGCTTGGAGACCCCCTTCCC
CACCCTCCCCACCGACCCCGGACCCCGCACCGGCGTCGCCCCCGTGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTTCCAAGTTCTTCACCTCCCTCGTCTCCCTCGCTGCTGTCCTGGGTGCTAACGCTTCCCTGACGCGCCGTGTTGCGTGCCCCGACGGCAGGCACACCGCTACCAACGCGGCTTGC
TGCGCTCTCTTCCCTCTCCGGGACGATCTCCAGGCCAACCTCTTCGACGGCGGCAAGTGCAACGCTGAGGCGCACGAGTCTCTCCGCTTGACGTTCCACGACGCCATCGCCATCTCGCCG
GCCCTGGAGGCGCAGGGCAA
CGGTGGAGGTGCCGACGGCTCCATCACGATCTTTTCGCACATCGAGACGGGCTTCCACCCCAACATCGGTCTCGACGAGGTTGTCGAGAAGCAGCGGCCT
TTCCTCCAGCGCCACAACATCGGTGTTGCTGACTT
CATTCAATTCGCCGGTGCCCTCGGTGCGTCCAACTGCGCAGGTGCTCCCCAGCTCAGCGCCTTCGTCGGCCGCAAGGACGCGACT
CGCCCCGCCCCCGACGGTCTCGTCCCGGAGCCGTTCCACACGCCCGACCAGATCTTCGCCCGCATCGCCGACGCGTCCTCGGGCGAGTTCGACGAGATCCTGACCGTCTGGCTGCTCACC
GCGCACACGATCGCCGCCGCCAACGACGTCGACCCGACCGTGCCCGGCTCGCCGTTCGACTCCACCCCCGAGATCTTCGACTCGCAGTTCTTCCTCGAGACGCAGCTCAAGGGCACCGCC
TTCACCGGGCGCGGCCCCGTCCAGGGCGAGGTCACGTCCCCGCTGCGCGGCGAGTTCCGCCTGCAGTCCGACTTCGCGATCGCGCGCGACCAGCGCACCGCGTGCGAGTGGCAGTCGTTC
GTCAACAACCAGACTAAGGTCCAGCAGATGTTCCAGTTCGTCTTCCACGACCTCTCCATCCTCGGCCAGAACATCGACGACCTCGTTGACTGCACGGAAGTG
ATCCCGATCCCCAGGCCC
CTCACCACCAGGACCCACTTCCCCGCCGGCATGACCCACCGCGACATCGAGCAGGCT
TGCTTGGAGACCCCCTTCCCCACCCTCCCCACCGACCCCGGACCCCGCACCGGCGTCGCCCCC
GTGTAA

Retrieve as FASTA