Entry information : FmeMnP13
Entry ID 9610
Creation 2011-10-14 (Christophe Dunand)
Last sequence changes 2011-10-14 (Christophe Dunand)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2016-06-01 (Catherine Mathe)
Peroxidase information: FmeMnP13
Name FmeMnP13
Class Manganese peroxidase    [Orthogroup: MnP005]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Hymenochaetaceae Fomitiporia
Organism Fomitiporia mediterranea    [TaxId: 208960 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value FmeMnP13
start..stop
S start..stop
FmeMnP12 570 0 1..344 1..344
FmeMnP14 468 2e-167 1..344 1..341
FmeCIIBB01 365 2e-126 18..341 18..354
PcriCIIBB07 357 4e-123 1..341 1..356
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3292602..3293115 514 N° 2 3292164..3292541 378 N° 3 3291978..3292107 130 N° 4 3291909..3291921 13
complement(join(3291909..3291921,3291978..3292107,3292164..3292541,3292602..3293 115))


exon

Literature and cross-references FmeMnP13
DNA ref. JGI genome:   scaffold_1 (3293115..3291909)
Protein sequence: FmeMnP13
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   344 (323)
PWM (Da):   %s   35952.49 (33719.3)  
PI (pH):   %s   4.2 (4.16) Peptide Signal:   %s   cut: 22 range:22-344
Sequence 385
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSFKTLFAITSLVTTLSGTYAALTRRVSCPDGVNTATNEACCAFFALRDDLQSNLFENECGEEVRGALRLTFHDGIAFSPTLGGGGADGSILTFSDTELTFAANGGNGGVEDFVTTMVPFLSRHNVSAGDLVHFAGALGITNCEGTPRVQFFAGRPNAVAAAPDGLVSQPGDPIDTIIERFADAGFSTDELVSLLASHSISAADTITGANRGAPFDSTNHVFDSQFFIETRLHSAVPGEGRLPSDVAIARDDRTSCLWQSFITDEDAMRNAFGAGLTKLSLTGQDVSQLVDCSELIPQPAAHVPDPFFPGTATITDVDAACTQTPFPALTQNPAVTSVAHVNEF

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTTCAAGACCCTCTTCGCAATCACTTCGCTCGTCACAACGCTCTCTGGCACTTATGCGGCGCTCACCCGCCGTGTCAGCTGTCCTGATGGCGTTAACACCGCGACGAACGAGGCC
TGCTGTGCATTCTTCGCTCTTCGTGATGACCTCCAGAGCAATCTGTTTGAAAATGAATGCGGTGAAGAGGTCCGTGGAGCTCTCCGTCTCACCTTCCACGACGGTATTGCATTCTCGCCA
ACTCTCGGTGGCGGCGGAGCCGATGGCTCGATCCTCACATTTTCTGACACCGAGTTGACGTTCGCCGCCAACGGTGGTAACGGCGGTGTCGAAGATTTCGTCACTACAATGGTGCCTTTC
CTCTCAAGGCACAATGTTTCTGCTGGTGACTTGGTTCACTTTGCTGGCGCACTTGGCATCACGAACTGCGAAGGTACACCCAGAGTTCAGTTCTTCGCGGGTCGCCCGAATGCTGTTGCC
GCAGCTCCTGATGGTCTCGTTTCTCAACCAGGAG
GTACTTTACTATACCGACTTTAGCATGTACAATTTAATGACGCCTCTATTATCCTTCTAGACCCTATTGACACTATCATTGAACGC
TTCGCCGACGCCGGTTTCAGTACAGACGAACTTGTCTCTTTACTCGCATCTCACTCGATTAGCGCTGCTGACACGATTACCGGAGCGAACCGAGGAGCGCCATTCGACAGTACAAATCAC
GTTTTCGACAGTCAATTCTTCATCGAGACGCGCCTGCATTCCGCGGTTCCTGGAGAGGGTCGCCTTCCGTCCGACGTGGCGATTGCTCGTGACGACCGTACATCATGCTTGTGGCAGAGC
TTCATTACTGACGAGGATGCGATGCGAAATGCCTTCGGTGCCGGATTGACCAAGCTTTCGCTCACTGGCCAAGACGTATCGCAGCTCGTTGACTGCTCAGAACTCATTCCTC
GTACGTTA
CCTGCGAAATCGCTTCTTGACCCACTGCGCTGACAAACTTTCCTCAAGAACCCGCGGCCCATGTTCCGGACCCGTTCTTCCCTGGAACTGCAACTATCACCGATGTCGATGCAGCGTGCA
CACAGACGCCCTTCCCTGCTCTCACGCAGAACCCAGCCGTCACGAGCGTCGCTCACGT
GTAAGTGTATATATTACCTTTTAGCATTACACATCTACTAAATGATATCTCATTAGCAACGA
GTTCTA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTTCAAGACCCTCTTCGCAATCACTTCGCTCGTCACAACGCTCTCTGGCACTTATGCGGCGCTCACCCGCCGTGTCAGCTGTCCTGATGGCGTTAACACCGCGACGAACGAGGCC
TGCTGTGCATTCTTCGCTCTTCGTGATGACCTCCAGAGCAATCTGTTTGAAAATGAATGCGGTGAAGAGGTCCGTGGAGCTCTCCGTCTCACCTTCCACGACGGTATTGCATTCTCGCCA
ACTCTCGGTGGCGGCGGAGCCGATGGCTCGATCCTCACATTTTCTGACACCGAGTTGACGTTCGCCGCCAACGGTGGTAACGGCGGTGTCGAAGATTTCGTCACTACAATGGTGCCTTTC
CTCTCAAGGCACAATGTTTCTGCTGGTGACTTGGTTCACTTTGCTGGCGCACTTGGCATCACGAACTGCGAAGGTACACCCAGAGTTCAGTTCTTCGCGGGTCGCCCGAATGCTGTTGCC
GCAGCTCCTGATGGTCTCGTTTCTCAACCAGGAG
ACCCTATTGACACTATCATTGAACGCTTCGCCGACGCCGGTTTCAGTACAGACGAACTTGTCTCTTTACTCGCATCTCACTCGATT
AGCGCTGCTGACACGATTACCGGAGCGAACCGAGGAGCGCCATTCGACAGTACAAATCACGTTTTCGACAGTCAATTCTTCATCGAGACGCGCCTGCATTCCGCGGTTCCTGGAGAGGGT
CGCCTTCCGTCCGACGTGGCGATTGCTCGTGACGACCGTACATCATGCTTGTGGCAGAGCTTCATTACTGACGAGGATGCGATGCGAAATGCCTTCGGTGCCGGATTGACCAAGCTTTCG
CTCACTGGCCAAGACGTATCGCAGCTCGTTGACTGCTCAGAACTCATTCCTC
AACCCGCGGCCCATGTTCCGGACCCGTTCTTCCCTGGAACTGCAACTATCACCGATGTCGATGCAGCG
TGCACACAGACGCCCTTCCCTGCTCTCACGCAGAACCCAGCCGTCACGAGCGTCGCTCACGT
CAACGAGTTCTA

Retrieve as FASTA