Entry information : FmeMnP08 (MnP8-long)
Entry ID 9614
Creation 2011-10-14 (Christophe Dunand)
Last sequence changes 2011-10-14 (Christophe Dunand)
Sequence status complete
Reviewer Nizar Fawal
Last annotation changes 2012-10-29 (Nizar Fawal)
Peroxidase information: FmeMnP08 (MnP8-long)
Name (synonym) FmeMnP08 (MnP8-long)
Class Manganese peroxidase    [Orthogroup: MnP003]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Hymenochaetaceae Fomitiporia
Organism Fomitiporia mediterranea    [TaxId: 208960 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value FmeMnP08
start..stop
S start..stop
FmeMnP01 555 0 1..366 1..370
FmeMnP11 493 5e-176 2..369 1..368
FmeMnP02 489 9e-175 2..369 1..369
FmeMnP06 486 2e-173 1..369 1..369
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 417804..417869 66 N° 2 417631..417745 115 N° 3 417506..417569 64 N° 4 417399..417454 56
N° 5 417240..417343 104 N° 6 416725..417186 462 N° 7 416482..416656 175 N° 8 416344..416411 68
complement(join(416344..416411,416482..416656,416725..417186,417240..417343,4173 99..417454,417506..417569,417631..417745,417804..417869))


exon

Literature and cross-references FmeMnP08 (MnP8-long)
DNA ref. JGI genome:   scaffold_19 (417869..416344)
Protein sequence: FmeMnP08 (MnP8-long)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   369 (351)
PWM (Da):   %s   39373.38 (37553.4)  
PI (pH):   %s   4.57 (4.52) Peptide Signal:   %s   cut: 19 range:19-369
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVFKLSIAFVALASLASAATLHRTPCPNSKNTAINPQCCVFYDLADELQNNKFDNECGEDAHEALRLTFHDAIGFSASGKLKGTGADGSIMLFNGTELQHANDGVEDAINNLAPLLHDFKVSAGDLIQFAGAVVSNCPGAPRLEFLAGRPNATSPAQQGTVPLPQDPVDKILARMQDAGLTPEDTVNLLSSHTVARSDTLVPGHDAVPFDTTPFTFDTQVFLEVLLKGVGVPFGVNNTDGAEVNSPLPAEGEMRLQSDFAIARDPVTACFWQDMINNQQKMMNAFQTSMSKMAILGHDRRGLYDCSEAVPVPKPPVKKPATFPATKNIKDVEQVCRKPFPTLSTDRGAETTIPACVNGDTNIDDCPS

Retrieve as FASTA  
Remarks Complete sequence from genomic (7 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTCTTCAAGCTTTCCATTGCGTTCGTCGCACTCGCTTCACTGGCTAGTGCAGCTACCCTTCATGTACGCGATTTGCTCTCTGTGATTAGTCCAGACTTTAACTAGGTTGTCTTGTTT
CTAGAGGACTCCCTGCCCGAACAGCAAGAACACTGCAATCAACCCGCAGTGCTGTGTGTTCTATGATCTCGCAGATGAGTTACAGAACAACAAGTTCGACAATGAGTGTGGAGAGGATGG
TAGGCATCTACCCATTGGAGTAGTGAATATCACTTACTTACGATGTTGTACAATTCACAGCTCACGAAGCCCTTCGCCTTACCTTCCACGACGCTATCGGGTTCTCTGCGTCTGGAAAAC
TGAA
GTGAGTCATATTTTCTCGCTATGGATTTCTTTTGCTTACGCCCATGTGCAGGGGAACCGGCGCAGATGGTTCCATTATGCTCTTCAACGGAACTGAACTGCAAGACCGTGAGTATT
ATGGTCATATTGTTTTTCAATATTACTGAAGTATCTTCTGGAACAGATGCTAATGACGGTGTTGAGGATGCCATCAACAACCTCGCACCACTCCTTCACGACTTCAAGGTCTCCGCAGGA
GACCTCATCCAATTCGCGGGAGCAGTTGCT
GTATGTAGACAATATTCCATGATATGCGGCGATGTTACTGATTGTTTCTCTAGGTCTCGAACTGCCCAGGCGCCCCTCGCCTTGAGTTCC
TTGCAGGTCGTCCCAACGCAACCTCCCCTGCTCAGCAGGGTACCGTTCCCTTACCGCAAGACCCAGTTGACAAGATTCTCGCACGTATGCAAGATGCAGGTCTCACCCCAGAAGATACCG
TCAACCTCCTCTCTTCGCACACCGTCGCACGTTCAGATACTCTTGTTCCGGGCCACGACGCGGTTCCCTTTGACACTACGCCCTTTACATTCGACACTCAAGTCTTCCTTGAAGTGCTGC
TCAAGGGTGTGGGTGTACCGTTCGGCGTGAACAACACCGACGGTGCAGAAGTCAACTCGCCGCTCCCTGCCGAGGGCGAAATGCGCTTACAATCCGACTTTGCCATTGCTCGCGACCCGG
TCACTGCGTGCTTCTGGCAAGATATGATCAATAACCAGCAGAAGATGATGAATGCGTTCCAAACC
GTGAGTTCATACCTCATCTATGTCTCCATTAGAAAAGAATTCTGATATAAGATGT
GACTGATACCTAGTCCATGTCGAAGATGGCCATTCTCGGACACGACAGGCGCGGGCTCTACGACTGCTCCGAAGCTGTTCCCGTTCCTAAGCCTCCTGTCAAGAAGCCAGCGACGTTCCC
TGCTACCAAGAATATCAAGGACGTCGAACAAGTCTGCCGCAAGCCGTTCCCTACGCTCTCAACTGACC
GTAAGCATTTATTCACTATATTATGTCCCCAAAAAAATTCTAACGATTTCCT
TTCTTTTCCCTTTTATAGGTGGTGCGGAAACCACAATTCCGGCTTGCGTCAATGGCGACACCAACATCGACGACTGCCCATCCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTCTTCAAGCTTTCCATTGCGTTCGTCGCACTCGCTTCACTGGCTAGTGCAGCTACCCTTCATAGGACTCCCTGCCCGAACAGCAAGAACACTGCAATCAACCCGCAGTGCTGTGTG
TTCTATGATCTCGCAGATGAGTTACAGAACAACAAGTTCGACAATGAGTGTGGAGAGGATG
CTCACGAAGCCCTTCGCCTTACCTTCCACGACGCTATCGGGTTCTCTGCGTCTGGAAAA
CTGAA
GGGAACCGGCGCAGATGGTTCCATTATGCTCTTCAACGGAACTGAACTGCAAGACCATGCTAATGACGGTGTTGAGGATGCCATCAACAACCTCGCACCACTCCTTCACGACTTC
AAGGTCTCCGCAGGAGACCTCATCCAATTCGCGGGAGCAGTTGCT
GTCTCGAACTGCCCAGGCGCCCCTCGCCTTGAGTTCCTTGCAGGTCGTCCCAACGCAACCTCCCCTGCTCAGCAG
GGTACCGTTCCCTTACCGCAAGACCCAGTTGACAAGATTCTCGCACGTATGCAAGATGCAGGTCTCACCCCAGAAGATACCGTCAACCTCCTCTCTTCGCACACCGTCGCACGTTCAGAT
ACTCTTGTTCCGGGCCACGACGCGGTTCCCTTTGACACTACGCCCTTTACATTCGACACTCAAGTCTTCCTTGAAGTGCTGCTCAAGGGTGTGGGTGTACCGTTCGGCGTGAACAACACC
GACGGTGCAGAAGTCAACTCGCCGCTCCCTGCCGAGGGCGAAATGCGCTTACAATCCGACTTTGCCATTGCTCGCGACCCGGTCACTGCGTGCTTCTGGCAAGATATGATCAATAACCAG
CAGAAGATGATGAATGCGTTCCAAACC
TCCATGTCGAAGATGGCCATTCTCGGACACGACAGGCGCGGGCTCTACGACTGCTCCGAAGCTGTTCCCGTTCCTAAGCCTCCTGTCAAGAAG
CCAGCGACGTTCCCTGCTACCAAGAATATCAAGGACGTCGAACAAGTCTGCCGCAAGCCGTTCCCTACGCTCTCAACTGACC
GTGGTGCGGAAACCACAATTCCGGCTTGCGTCAATGGC
GACACCAACATCGACGACTGCCCATCCTAA

Retrieve as FASTA