Entry information : FmeMnP04 (MnP4-long)
Entry ID 9616
Creation 2011-10-14 (Christophe Dunand)
Last sequence changes 2011-10-14 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-03-22 (Catherine Mathe (Scipio))
Peroxidase information: FmeMnP04 (MnP4-long)
Name (synonym) FmeMnP04 (MnP4-long)
Class Manganese peroxidase    [Orthogroup: MnP003]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Hymenochaetaceae Fomitiporia
Organism Fomitiporia mediterranea    [TaxId: 208960 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value FmeMnP04
start..stop
S start..stop
FmeMnP02 581 0 1..368 1..369
FmeMnP11 558 0 19..368 19..368
FmeMnP10 550 0 19..368 19..368
FmeMnP06 541 0 3..368 4..369
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 805898..806005 108 N° 2 805113..805833 721 N° 3 804915..805050 136 N° 4 804720..804861 142
complement(join(804720..804861,804915..805050,805113..805833,805898..806005))


exon

Literature and cross-references FmeMnP04 (MnP4-long)
DNA ref. JGI genome:   scaffold_3 (806005..804720)
Protein sequence: FmeMnP04 (MnP4-long)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   368 (351)
PWM (Da):   %s   38032.32 (36346.4)  
PI (pH):   %s   3.89 (3.85) Peptide Signal:   %s   cut: 18 range:18-368
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSKLSVAFVALAALVNAANYKRVTCPDGVNTATNEACCPFFALRDDLQANLFNNTCGEDVHETLRLTFHDAIGFSSSGALSGGGADGSIILFSGTELAFVANAGVDDGVDALAPFLQTHNVTAGDLIQFAGAVGTTNCPGAPKLQFLAGRANATAPASDGTVPLPQDSADSILSRMADAGISNLEVIHLLASHSIARSDTLVPNHTAVPFDTTPFTFDPQIFLEVLLKGTGIPFGVNNTDGAEVDSPLPDEGEMRLQSDFVLSRDSRTACEWQSMIADQQLMMSNFQSAMAKMAVIGFDSSTLVDCSEVIPDPIAPVGSAAVFPAGTSQDDVEQACTSAFPSLSTDAGSATQIPACPDGDLNINDCPS

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTAAACTCTCTGTCGCTTTCGTCGCACTTGCAGCACTAGTAAATGCTGCTAACTACAAACGTGTTACTTGCCCAGATGGGGTCAATACCGCAACCAACGAGGCGGTACGTCTTCAT
TCCTACTCTCTCTACATCTACCCGATAACGAACTAATTATCTTTCGTTCCAGTGCTGTCCATTCTTCGCGCTCAGAGATGACCTCCAGGCGAATTTGTTCAACAATACTTGCGGAGAAGA
CGTGCACGAAACGTTGCGACTTACCTTCCATGATGCTATCGGCTTTTCCTCTTCTGGTGCACTCTCTGGGGGTGGTGCTGACGGCTCCATCATACTCTTCTCCGGCACCGAGCTTGCGTT
TGTTGCAAATGCTGGTGTTGACGATGGCGTGGATGCGCTCGCGCCATTCTTGCAGACCCATAACGTCACTGCTGGTGACTTGATCCAGTTTGCAGGTGCGGTGGGAACTACAAACTGTCC
TGGAGCCCCAAAGTTGCAGTTCCTTGCAGGTAGAGCAAACGCGACTGCTCCCGCCTCGGACGGGACCGTCCCACTGCCGCAAGATAGCGCAGATTCGATTCTTTCTCGAATGGCCGATGC
AGGTATCTCCAACTTAGAGGTCATCCATTTGCTTGCGTCGCATAGTATCGCTCGTTCGGATACACTCGTCCCGAATCATACGGCTGTACCATTCGATACGACACCGTTTACATTCGACCC
ACAGATCTTTTTGGAAGTCTTGCTTAAAGGCACTGGCATCCCATTCGGTGTGAACAATACCGATGGTGCAGAGGTGGACTCGCCTCTCCCCGATGAAGGCGAGATGCGCCTTCAGTCAGA
TTTCGTACTCTCGCGCGACTCTCGCACAGCTTGTGAATGGCAGTCTATGATTG
GTATGTACTACCTTGCTTTGGATGCATTGTATGACAATAACTTATGTCAATCTTGAATGAAGCGGAT
CAACAACTTATGATGAGCAACTTCCAGTCAGCGATGGCGAAGATGGCTGTCATTGGGTTCGATAGCAGCACACTTGTTGACTGTTCGGAAGTCATCCCAGACCCAATTGCTCCTGTTGGA
TCTGCTGCTGT
GTAAGTCGAGCTCGTGCTTTCTAAGTAGTTTACTCACGTCCACGGTCCCCCAGGTTCCCTGCTGGCACGAGCCAAGACGACGTCGAACAAGCATGCACGTCTGCATTCC
CATCGCTGTCCACAGATGCAGGCTCAGCGACGCAAATTCCGGCGTGCCCTGACGGAGACCTCAACATTAATGACTGTCCGTCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTAAACTCTCTGTCGCTTTCGTCGCACTTGCAGCACTAGTAAATGCTGCTAACTACAAACGTGTTACTTGCCCAGATGGGGTCAATACCGCAACCAACGAGGCGTGCTGTCCATTC
TTCGCGCTCAGAGATGACCTCCAGGCGAATTTGTTCAACAATACTTGCGGAGAAGACGTGCACGAAACGTTGCGACTTACCTTCCATGATGCTATCGGCTTTTCCTCTTCTGGTGCACTC
TCTGGGGGTGGTGCTGACGGCTCCATCATACTCTTCTCCGGCACCGAGCTTGCGTTTGTTGCAAATGCTGGTGTTGACGATGGCGTGGATGCGCTCGCGCCATTCTTGCAGACCCATAAC
GTCACTGCTGGTGACTTGATCCAGTTTGCAGGTGCGGTGGGAACTACAAACTGTCCTGGAGCCCCAAAGTTGCAGTTCCTTGCAGGTAGAGCAAACGCGACTGCTCCCGCCTCGGACGGG
ACCGTCCCACTGCCGCAAGATAGCGCAGATTCGATTCTTTCTCGAATGGCCGATGCAGGTATCTCCAACTTAGAGGTCATCCATTTGCTTGCGTCGCATAGTATCGCTCGTTCGGATACA
CTCGTCCCGAATCATACGGCTGTACCATTCGATACGACACCGTTTACATTCGACCCACAGATCTTTTTGGAAGTCTTGCTTAAAGGCACTGGCATCCCATTCGGTGTGAACAATACCGAT
GGTGCAGAGGTGGACTCGCCTCTCCCCGATGAAGGCGAGATGCGCCTTCAGTCAGATTTCGTACTCTCGCGCGACTCTCGCACAGCTTGTGAATGGCAGTCTATGATTG
CGGATCAACAA
CTTATGATGAGCAACTTCCAGTCAGCGATGGCGAAGATGGCTGTCATTGGGTTCGATAGCAGCACACTTGTTGACTGTTCGGAAGTCATCCCAGACCCAATTGCTCCTGTTGGATCTGCT
GCTGT
GTTCCCTGCTGGCACGAGCCAAGACGACGTCGAACAAGCATGCACGTCTGCATTCCCATCGCTGTCCACAGATGCAGGCTCAGCGACGCAAATTCCGGCGTGCCCTGACGGAGAC
CTCAACATTAATGACTGTCCGTCTTGA

Retrieve as FASTA