Entry information : FmeMnP02 (MnP2-long)
Entry ID 9617
Creation 2011-10-14 (Christophe Dunand)
Last sequence changes 2011-10-14 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2013-09-16 (Christophe Dunand)
Peroxidase information: FmeMnP02 (MnP2-long)
Name (synonym) FmeMnP02 (MnP2-long)
Class Manganese peroxidase    [Orthogroup: MnP003]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Hymenochaetaceae Fomitiporia
Organism Fomitiporia mediterranea    [TaxId: 208960 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value FmeMnP02
start..stop
S start..stop
FmeMnP11 635 0 1..369 1..368
FmeMnP10 635 0 1..369 1..368
FmeMnP06 565 0 1..369 2..369
FmeMnP05 562 0 1..369 2..368
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4393836..4393943 108 N° 2 4394005..4394084 80 N° 3 4394145..4394785 641 N° 4 4394848..4394983 136
N° 5 4395042..4395186 145  
join(4393836..4393943,4394005..4394084,4394145..4394785,4394848..4394983,4395042 ..4395186)


exon

Literature and cross-references FmeMnP02 (MnP2-long)
DNA ref. JGI genome:   scaffold_4 (4393836..4395186)
Cluster/Prediction ref. JGI gene:   145801
Protein sequence: FmeMnP02 (MnP2-long)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   369 (352)
PWM (Da):   %s   38627.8 (36988.8)  
PI (pH):   %s   4.04 (4.00) Peptide Signal:   %s   cut: 18 range:18-369
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLKLAIATIALATSVAAANYKRVTCPDGVNTATNEACCAFFALRDDLQNNLFEGECGEDVHESLRLTFHDAIGFSGSGAFKGTGADGSIILFSDTELADPANAGIDDPVHAIAPFLTRHNVTAGDLIQFAGALGITNCPGAPRLEFLAGRPNATFPVDPGSVPLPQSPADLILSRMEDGGFSDAETIHLLVSHTIARSDTLVPGHEAVPFDTTPFTFDPQIFLEVLLQGNGIPFGVNNTDGAEVDSPLPQSGEMRLQSDFVLARDSRTACEWQSMANQQLMMQNFQSAMAKLAIVGHNRNQLIDCSELIPSPIAPVSSAATFPAGTSPDDVQQACAETPFPSLAATGGQATQIPACPDGDLNLDDCPS

Retrieve as FASTA  
Remarks Complete sequence from genomic
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTCAAGCTCGCTATCGCCACTATTGCACTAGCCACGTCTGTTGCTGCCGCCAACTACAAGCGTGTCACCTGCCCCGATGGCGTAAACACGGCGACGAATGAGGCTGTATGCCAGTCT
CCTTGCTACCCTCGGCAGGACTTTCATGCTAACGTCGTTATCTTCTCAGTGCTGTGCATTCTTTGCCCTCAGGGATGATCTTCAGAACAATCTCTTTGAGGGTGAGTGCGGCGAGGATGT
CCACGAATC
GTAAGTAAAGTTCGATTGTACGTCAATTGGATCTGACCTTGATCTTCCACTTTGCGCCAGCCTCCGTCTCACCTTCCACGACGCTATTGGCTTCTCCGGGTCTGGTGCGTT
CAAGGGAACGGGTGCCGATGGTTCAATCATCTTGTTCTCCGACACCGAACTCGCTGATCCAGCCAATGCTGGTATCGATGATCCGGTCCATGCAATTGCACCGTTCCTCACGCGCCACAA
TGTGACTGCTGGTGATTTGATCCAGTTCGCTGGTGCGCTCGGCATCACGAACTGCCCCGGCGCGCCTAGGTTGGAATTCCTCGCGGGTAGACCGAATGCGACGTTCCCAGTGGACCCGGG
ATCCGTTCCTCTACCTCAGAGCCCTGCCGACTTGATCCTCTCGCGTATGGAGGATGGCGGCTTCAGTGATGCAGAGACGATTCACTTGCTTGTGAGCCACACGATTGCGCGTTCTGACAC
CCTGGTCCCTGGTCACGAGGCTGTTCCGTTCGACACTACTCCCTTCACGTTCGACCCGCAAATTTTCCTCGAGGTCCTGCTCCAGGGTAACGGCATCCCGTTCGGCGTGAACAACACTGA
TGGCGCAGAGGTCGACTCACCGCTTCCTCAGTCTGGAGAGATGCGCCTCCAGTCTGACTTTGTTCTCGCTCGCGACTCCCGCACGGCCTGCGAGTGGCAATCAATGGTTG
GTAAGTAGCA
GTGTTTGATAATCTCTCTGTCGACCTGAAACAGTTGCTGATGTTTTCTATAGCAAACCAGCAATTGATGATGCAGAACTTCCAGTCGGCCATGGCTAAGCTGGCTATTGTTGGACACAAC
CGCAATCAACTCATTGACTGCTCTGAGCTTATCCCGAGCCCGATTGCACCAGTCAGCTCTGCCGCAAC
GTGAGCATTTGGTTTCTACCTTAGAATTGTGCGGTCTCTGACATATTTCTGG
TTTCAGCTTCCCTGCGGGTACGAGCCCAGACGACGTCCAACAGGCTTGCGCAGAGACGCCCTTCCCGTCGTTGGCGGCTACCGGTGGACAAGCGACTCAGATTCCAGCTTGCCCTGACGG
TGACCTTAACCTCGACGATTGCCCGTCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTCAAGCTCGCTATCGCCACTATTGCACTAGCCACGTCTGTTGCTGCCGCCAACTACAAGCGTGTCACCTGCCCCGATGGCGTAAACACGGCGACGAATGAGGCTTGCTGTGCATTC
TTTGCCCTCAGGGATGATCTTCAGAACAATCTCTTTGAGGGTGAGTGCGGCGAGGATGTCCACGAATC
CCTCCGTCTCACCTTCCACGACGCTATTGGCTTCTCCGGGTCTGGTGCGTTC
AAGGGAACGGGTGCCGATGGTTCAATCATCTTGTTCTCCGACACCGAACTCGCTGATCCAGCCAATGCTGGTATCGATGATCCGGTCCATGCAATTGCACCGTTCCTCACGCGCCACAAT
GTGACTGCTGGTGATTTGATCCAGTTCGCTGGTGCGCTCGGCATCACGAACTGCCCCGGCGCGCCTAGGTTGGAATTCCTCGCGGGTAGACCGAATGCGACGTTCCCAGTGGACCCGGGA
TCCGTTCCTCTACCTCAGAGCCCTGCCGACTTGATCCTCTCGCGTATGGAGGATGGCGGCTTCAGTGATGCAGAGACGATTCACTTGCTTGTGAGCCACACGATTGCGCGTTCTGACACC
CTGGTCCCTGGTCACGAGGCTGTTCCGTTCGACACTACTCCCTTCACGTTCGACCCGCAAATTTTCCTCGAGGTCCTGCTCCAGGGTAACGGCATCCCGTTCGGCGTGAACAACACTGAT
GGCGCAGAGGTCGACTCACCGCTTCCTCAGTCTGGAGAGATGCGCCTCCAGTCTGACTTTGTTCTCGCTCGCGACTCCCGCACGGCCTGCGAGTGGCAATCAATGGTTG
CAAACCAGCAA
TTGATGATGCAGAACTTCCAGTCGGCCATGGCTAAGCTGGCTATTGTTGGACACAACCGCAATCAACTCATTGACTGCTCTGAGCTTATCCCGAGCCCGATTGCACCAGTCAGCTCTGCC
GCAAC
CTTCCCTGCGGGTACGAGCCCAGACGACGTCCAACAGGCTTGCGCAGAGACGCCCTTCCCGTCGTTGGCGGCTACCGGTGGACAAGCGACTCAGATTCCAGCTTGCCCTGACGGT
GACCTTAACCTCGACGATTGCCCGTCTTAA

Retrieve as FASTA