Entry information : FmeMnP05 (MnP5-long)
Entry ID 9618
Creation 2011-10-14 (Christophe Dunand)
Last sequence changes 2011-10-14 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-03-22 (Catherine Mathe (Scipio))
Peroxidase information: FmeMnP05 (MnP5-long)
Name (synonym) FmeMnP05 (MnP5-long)
Class Manganese peroxidase    [Orthogroup: MnP003]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Hymenochaetaceae Fomitiporia
Organism Fomitiporia mediterranea    [TaxId: 208960 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value FmeMnP05
start..stop
S start..stop
FmeMnP06 629 0 1..368 1..369
FmeMnP02 574 0 2..368 1..369
FmeMnP11 553 0 2..368 1..368
FmeMnP10 541 0 2..368 1..368
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 853264..853371 108 N° 2 852905..853200 296 N° 3 852459..852852 394 N° 4 852224..852390 167
N° 5 852093..852166 74 N° 6 851961..852028 68  
complement(join(851961..852028,852093..852166,852224..852390,852459..852852,8529 05..853200,853264..853371))


exon

Literature and cross-references FmeMnP05 (MnP5-long)
DNA ref. JGI genome:   scaffold_6 (853371..851961)
Protein sequence: FmeMnP05 (MnP5-long)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   368 (350)
PWM (Da):   %s   39064.13 (37346.2)  
PI (pH):   %s   4.35 (4.31) Peptide Signal:   %s   cut: 19 range:19-368
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVFKLAAATIAFAALAGAVNFRRVTCPDGNIASHEACCAFFALRDDLQENLFDGECGEDVHESLRLTFHDAIGFSRSGKLKGGGADGSMILFSDIETNFAANAGIDDSVDALSPFLTRHLVTAGDLIQFAGAVGTTNCPGAPRLQFLAGRPNATFPADDNTVPLPQSDVTTILERMEDGGFSPAELIHLLASHTIARSDTLVAGHEAVPFDTTPFTFDTQIFLEVLLKGVGVPFGINNTDGAEVDSPIPNSGEMRLQSDFALARDRTACEWQSMVDNQQLMMNNFKSAMAKLAVVGHNPNNLVDCSEVVPQAKPPVRKPATFPAGTSRADVQQACPEPFPVLRTPGQATQIPACPDGDLNLDDCPS

Retrieve as FASTA  
Remarks Complete sequence from genomic (5 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTCTTCAAACTTGCCGCTGCAACCATTGCTTTCGCTGCCCTTGCTGGCGCGGTCAACTTCAGGCGTGTTACTTGTCCTGACGGTAACATCGCCAGTCACGAAGCTGTTTGTCCCCCT
CCATCGTTCTGTCACCTACGTGACAGATTTCTTACTAATTCGATTCTCTAGTGCTGTGCGTTCTTCGCACTCCGCGATGACCTCCAGGAGAACCTCTTCGACGGCGAATGCGGCGAAGAC
GTCCATGAATCCTTGCGTCTCACCTTCCACGATGCTATTGGCTTCTCCAGGTCCGGCAAGCTCAAGGGTGGAGGAGCTGACGGCTCCATGATCCTTTTCAGCGACATTGAGACCAACTTC
GCTGCAAACGCCGGTATTGACGACTCAGTGGACGCACTCTCGCCGTTCCTCACTCGTCACTTGGTCACCGCTGGCGATCTTATCCAGTTCGCTGGAGCTGTTGGAAC
GTATGTTATCCCC
CTTCTTCTACTTTCGTTATTGCTGAGACTTTCTCTTCAGTACCAACTGCCCTGGAGCACCGCGTCTCCAATTCCTTGCGGGTCGTCCAAACGCCACATTCCCTGCTGATGACAACACCGT
TCCATTGCCGCAGAGCGACGTGACTACGATCCTTGAGCGCATGGAAGACGGTGGCTTCTCACCCGCTGAACTTATCCATCTGCTTGCCTCTCATACTATAGCTCGTTCGGATACGCTCGT
CGCTGGCCATGAAGCAGTTCCATTTGATACGACACCGTTCACTTTTGATACGCAAATCTTCCTTGAAGTTCTGCTTAAGGGAGTCGGTGTTCCCTTCGGTATTAACAACACTGACGGTGC
AGAAGTCGATTCGCCCATTCCAAACTCTGGTGAGATGCGTCTGCAGTCTGACTTCGCGCTTGCTCGTGACCGA
GTACGTATGATCTCCGTCGTTTCCCCTCTGGCGATGCGTACTAACAA
TGTATGCTAAATTCCTTGTAGCGAACGGCTTGCGAGTGGCAGAGTATGGTTGATAACCAACAGTTAATGATGAATAACTTCAAGAGCGCCATGGCCAAGCTTGCGGTTGTCGGACACAAT
CCGAACAACCTCGTTGACTGCTCGGAAGTTGTCCCGCAAGCGAAGCCGCCCGTTAGGAAGCCAGCTAC
GTGAGTCCTCTTGTATCACTAGGTTGTATTTTACTCATCTAACAAAAATCTT
TGAAGATTCCCCGCCGGTACCAGTCGCGCTGACGTTCAACAAGCCTGCCCTGAACCTTTCCCGGTCCTCCGCACTGACCGTAAGTCTTAGTTCAAGTGACTTCTTCATTATACTTGCTAA
CAATATTGTTTTTACTCTCACAGCTGGTCAAGCTACTCAAATTCCGGCTTGCCCAGATGGCGACCTTAATCTCGACGACTGCCCATCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTCTTCAAACTTGCCGCTGCAACCATTGCTTTCGCTGCCCTTGCTGGCGCGGTCAACTTCAGGCGTGTTACTTGTCCTGACGGTAACATCGCCAGTCACGAAGCTTGCTGTGCGTTC
TTCGCACTCCGCGATGACCTCCAGGAGAACCTCTTCGACGGCGAATGCGGCGAAGACGTCCATGAATCCTTGCGTCTCACCTTCCACGATGCTATTGGCTTCTCCAGGTCCGGCAAGCTC
AAGGGTGGAGGAGCTGACGGCTCCATGATCCTTTTCAGCGACATTGAGACCAACTTCGCTGCAAACGCCGGTATTGACGACTCAGTGGACGCACTCTCGCCGTTCCTCACTCGTCACTTG
GTCACCGCTGGCGATCTTATCCAGTTCGCTGGAGCTGTTGGAAC
TACCAACTGCCCTGGAGCACCGCGTCTCCAATTCCTTGCGGGTCGTCCAAACGCCACATTCCCTGCTGATGACAAC
ACCGTTCCATTGCCGCAGAGCGACGTGACTACGATCCTTGAGCGCATGGAAGACGGTGGCTTCTCACCCGCTGAACTTATCCATCTGCTTGCCTCTCATACTATAGCTCGTTCGGATACG
CTCGTCGCTGGCCATGAAGCAGTTCCATTTGATACGACACCGTTCACTTTTGATACGCAAATCTTCCTTGAAGTTCTGCTTAAGGGAGTCGGTGTTCCCTTCGGTATTAACAACACTGAC
GGTGCAGAAGTCGATTCGCCCATTCCAAACTCTGGTGAGATGCGTCTGCAGTCTGACTTCGCGCTTGCTCGTGACCGA
CGAACGGCTTGCGAGTGGCAGAGTATGGTTGATAACCAACAG
TTAATGATGAATAACTTCAAGAGCGCCATGGCCAAGCTTGCGGTTGTCGGACACAATCCGAACAACCTCGTTGACTGCTCGGAAGTTGTCCCGCAAGCGAAGCCGCCCGTTAGGAAGCCA
GCTAC
ATTCCCCGCCGGTACCAGTCGCGCTGACGTTCAACAAGCCTGCCCTGAACCTTTCCCGGTCCTCCGCACTGACCCTGGTCAAGCTACTCAAATTCCGGCTTGCCCAGATGGCGAC
CTTAATCTCGACGACTGCCCATCTTAA

Retrieve as FASTA