Entry information : FmeMnP10 (MnP10-long)
Entry ID 9619
Creation 2011-10-14 (Christophe Dunand)
Last sequence changes 2011-10-14 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-03-22 (Catherine Mathe (Scipio))
Peroxidase information: FmeMnP10 (MnP10-long)
Name (synonym) FmeMnP10 (MnP10-long)
Class Manganese peroxidase    [Orthogroup: MnP003]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Hymenochaetaceae Fomitiporia
Organism Fomitiporia mediterranea    [TaxId: 208960 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value FmeMnP10
start..stop
S start..stop
FmeMnP11 663 0 1..368 1..368
FmeMnP02 660 0 1..368 1..369
FmeMnP05 547 0 1..368 2..368
FmeMnP06 541 0 1..368 2..369
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 361212..361319 108 N° 2 361376..362096 721 N° 3 362150..362285 136 N° 4 362343..362484 142
join(361212..361319,361376..362096,362150..362285,362343..362484)


exon

Literature and cross-references FmeMnP10 (MnP10-long)
DNA ref. JGI genome:   scaffold_8 (361212..362484)
Protein sequence: FmeMnP10 (MnP10-long)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   368 (351)
PWM (Da):   %s   38885.85 (37254.9)  
PI (pH):   %s   4.02 (3.98) Peptide Signal:   %s   cut: 18 range:18-368
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MFKLAVATVALATTAAAANYKRVTCPDGINTATNEACCAFFALRDDLQNNLFEGQCGEDVHESLRLTFHDAIGWSGSKTFKGDGADGSIILFRDTELADPANAGVDDPVDALSPFLTRHDVSAGDLIQFAGALGITNCAGAPRLEFLAGRPNATFPAQQGTVPLPQSPPDVILERMEDAGFSDAETIHLLVSHTIARSDTLVPGHEAVPFDSTPFTFDPQIFLEVLLKGTGLPFDVNNTDGAEVDSPLPSSGEMRLQSDFALARSDRTACEWQSMVADQQLMMSNFQAAMSRLAIVGHNRNQLVDCSELIPTPIAPVSSAATFPAGTSPDDVEQVCQEPFPSLAITGGQATQIPECPDGDLNLADCPS

Retrieve as FASTA  
Remarks complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTCAAGCTCGCTGTTGCTACCGTTGCTCTCGCTACTACTGCTGCTGCAGCCAACTATAAGCGCGTTACGTGTCCCGACGGTATTAACACTGCGACCAACGAGGCTGTACGTTAGGCT
TGTTGACTATTGACTTATTGGAACTGACAATAATTTGGTTTCAGTGTTGTGCGTTCTTTGCCCTCAGGGATGATTTGCAGAACAACCTCTTCGAGGGTCAATGTGGGGAGGATGTACACG
AAAGTCTTCGACTGACCTTCCATGATGCCATTGGTTGGTCTGGTTCGAAAACATTCAAGGGAGATGGAGCAGACGGTTCAATCATCTTGTTCAGAGACACTGAACTAGCCGACCCCGCCA
ACGCTGGAGTTGATGACCCTGTCGATGCCCTTTCACCATTCTTGACGCGTCATGATGTGTCTGCTGGTGACCTTATCCAGTTTGCTGGTGCTCTCGGTATCACGAACTGTGCTGGTGCAC
CTCGCTTGGAGTTCCTTGCGGGCCGACCGAATGCAACCTTCCCGGCTCAACAAGGAACGGTTCCTCTGCCACAGAGTCCGCCTGATGTTATCCTTGAACGTATGGAGGACGCTGGATTCA
GCGATGCAGAGACAATTCATTTGCTCGTGAGCCACACAATTGCACGCTCCGACACGTTGGTTCCTGGTCATGAGGCTGTTCCATTCGACTCGACACCATTCACGTTCGACCCTCAAATTT
TCCTTGAAGTCCTGCTCAAGGGTACCGGTCTCCCCTTCGATGTCAACAACACCGACGGTGCAGAAGTCGACTCACCGCTCCCTTCATCTGGCGAGATGCGTCTCCAGTCTGACTTCGCTC
TTGCTCGCTCCGACCGCACTGCTTGTGAATGGCAGTCCATGGTTG
GTGAGTATCGGCTGGTTATCAATTTTAGAGCCAATTTACTGATTCACCACCAGCGGACCAGCAATTGATGATGAG
CAACTTCCAGGCTGCTATGTCGAGGCTCGCCATTGTTGGGCACAATCGGAACCAACTCGTCGACTGCTCCGAGCTCATCCCAACACCGATTGCTCCAGTTAGCTCTGCTGCTAC
GTGAGT
ACTCCGTTTCTTCTATGGAAATAGGTTCACTGACTTACATTTCATTTCCAGGTTCCCTGCTGGCACTAGCCCAGACGACGTTGAGCAAGTCTGCCAAGAGCCATTCCCGTCCCTCGCTAT
TACTGGAGGCCAGGCAACTCAGATCCCGGAGTGCCCTGACGGTGACCTCAACCTTGCCGACTGCCCGTCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTCAAGCTCGCTGTTGCTACCGTTGCTCTCGCTACTACTGCTGCTGCAGCCAACTATAAGCGCGTTACGTGTCCCGACGGTATTAACACTGCGACCAACGAGGCTTGTTGTGCGTTC
TTTGCCCTCAGGGATGATTTGCAGAACAACCTCTTCGAGGGTCAATGTGGGGAGGATGTACACGAAAGTCTTCGACTGACCTTCCATGATGCCATTGGTTGGTCTGGTTCGAAAACATTC
AAGGGAGATGGAGCAGACGGTTCAATCATCTTGTTCAGAGACACTGAACTAGCCGACCCCGCCAACGCTGGAGTTGATGACCCTGTCGATGCCCTTTCACCATTCTTGACGCGTCATGAT
GTGTCTGCTGGTGACCTTATCCAGTTTGCTGGTGCTCTCGGTATCACGAACTGTGCTGGTGCACCTCGCTTGGAGTTCCTTGCGGGCCGACCGAATGCAACCTTCCCGGCTCAACAAGGA
ACGGTTCCTCTGCCACAGAGTCCGCCTGATGTTATCCTTGAACGTATGGAGGACGCTGGATTCAGCGATGCAGAGACAATTCATTTGCTCGTGAGCCACACAATTGCACGCTCCGACACG
TTGGTTCCTGGTCATGAGGCTGTTCCATTCGACTCGACACCATTCACGTTCGACCCTCAAATTTTCCTTGAAGTCCTGCTCAAGGGTACCGGTCTCCCCTTCGATGTCAACAACACCGAC
GGTGCAGAAGTCGACTCACCGCTCCCTTCATCTGGCGAGATGCGTCTCCAGTCTGACTTCGCTCTTGCTCGCTCCGACCGCACTGCTTGTGAATGGCAGTCCATGGTTG
CGGACCAGCAA
TTGATGATGAGCAACTTCCAGGCTGCTATGTCGAGGCTCGCCATTGTTGGGCACAATCGGAACCAACTCGTCGACTGCTCCGAGCTCATCCCAACACCGATTGCTCCAGTTAGCTCTGCT
GCTAC
GTTCCCTGCTGGCACTAGCCCAGACGACGTTGAGCAAGTCTGCCAAGAGCCATTCCCGTCCCTCGCTATTACTGGAGGCCAGGCAACTCAGATCCCGGAGTGCCCTGACGGTGAC
CTCAACCTTGCCGACTGCCCGTCTTAA

Retrieve as FASTA