Entry information : FmeMnP09 (MnP9-long)
Entry ID 9621
Creation 2011-10-14 (Christophe Dunand)
Last sequence changes 2011-10-14 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-03-22 (Catherine Mathe (Scipio))
Peroxidase information: FmeMnP09 (MnP9-long)
Name (synonym) FmeMnP09 (MnP9-long)
Class Manganese peroxidase    [Orthogroup: MnP003]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Hymenochaetaceae Fomitiporia
Organism Fomitiporia mediterranea    [TaxId: 208960 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value FmeMnP09
start..stop
S start..stop
FmeMnP06 532 0 1..369 1..367
FmeMnP05 519 0 1..369 1..366
FmeMnP02 513 0 2..369 1..367
FmeMnP07 509 0 1..369 1..369
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 31489..31599 111 N° 2 31655..32591 937 N° 3 32645..32709 65  
join(31489..31599,31655..32591,32645..32709)


exon

Literature and cross-references FmeMnP09 (MnP9-long)
DNA ref. JGI genome:   scaffold_6 (31489..32709)
Protein sequence: FmeMnP09 (MnP9-long)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   370 (352)
PWM (Da):   %s   38660.52 (37004.6)  
PI (pH):   %s   3.92 (3.89) Peptide Signal:   %s   cut: 19 range:19-370
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVFKLAVATVALAAAAGAANVKRVACPDGKNTASNEACCVFFALRDDLQNNLFQNECGEEVHEVVRLTFHDAVGFSNSGKFTGGGADGSILLFGDTETNFAANNGTDEAVDDLAPFLQTHNVTAGDLIQFGAAVGLTNCPGAPQLQFLAGRPNATAPAQDGTVPEPQDSVDDILARFSDVGINSDEVIHLLASHTIARSDTLVPNHDAVPFDSTPFTFDTQIFLEVLLKGVGLPFNETSSIPGAEVDSPIPDSGEMRLQSDFALARDSRTACEWQSMVDNQQLMMNNFRSAMMKLAVIGQDTNSLVDCSEVIPAPLPPVNKPASFPAGTDQTDVQQACTATAFPTLSADSGPETSIPACPDGGSDADNCS

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTCTTCAAGCTTGCTGTCGCTACTGTGGCTCTCGCTGCCGCTGCCGGAGCTGCCAACGTCAAGCGTGTTGCTTGCCCGGACGGCAAGAACACTGCAAGCAATGAAGCTGTCAGTCTG
CTCCCCTGCTCTTACTAGATAGTCTGATACTGACATCTCCACATAGTGCTGTGTCTTCTTTGCCCTCAGAGACGACCTTCAGAACAATCTTTTCCAAAACGAGTGTGGTGAAGAGGTTCA
TGAAGTCGTTCGTCTGACTTTCCACGACGCTGTTGGCTTCTCGAACAGCGGTAAATTCACCGGAGGTGGCGCGGATGGTTCAATCCTTCTCTTCGGGGACACCGAGACCAACTTCGCCGC
TAACAACGGCACCGATGAAGCGGTCGACGATCTCGCACCTTTCCTTCAGACTCACAACGTCACTGCAGGTGACCTGATTCAGTTCGGAGCTGCTGTTGGTTTAACGAACTGCCCTGGTGC
GCCTCAATTGCAGTTCCTCGCCGGTCGTCCGAATGCCACTGCACCTGCACAGGACGGCACCGTCCCGGAGCCTCAGGACAGCGTCGACGACATTCTCGCCCGCTTCTCCGACGTCGGCAT
CAACTCTGACGAAGTCATTCACCTCCTCGCTAGCCACACTATCGCTCGTTCAGACACGCTCGTCCCGAACCACGATGCAGTACCATTCGACTCGACTCCCTTCACTTTCGACACTCAGAT
CTTCTTGGAAGTCCTGCTCAAGGGTGTCGGCTTGCCCTTCAACGAGACCAGCAGCATTCCAGGCGCTGAAGTCGACTCTCCTATCCCTGACTCGGGCGAAATGCGGCTGCAGTCCGACTT
CGCCTTGGCGCGTGACTCGCGCACGGCGTGCGAATGGCAGAGCATGGTTGACAACCAGCAGCTTATGATGAACAACTTCCGCTCCGCAATGATGAAGCTCGCAGTTATCGGCCAAGACAC
TAACAGTCTTGTAGACTGCTCTGAAGTCATCCCAGCCCCCTTGCCTCCTGTCAACAAGCCCGCTTCGTTCCCCGCCGGCACCGACCAGACCGACGTCCAGCAGGCATGCACAGCTACGGC
GTTCCCAACTCTTAGCGCTGACT
GTGAGTAATTCCGACAATCTGTTTCATGATATCCTTACTAATTCTTCTTCCAGCCGGCCCCGAGACCTCCATCCCTGCCTGCCCTGATGGCGGCTCT
GACGCAGACAACTGCTCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTCTTCAAGCTTGCTGTCGCTACTGTGGCTCTCGCTGCCGCTGCCGGAGCTGCCAACGTCAAGCGTGTTGCTTGCCCGGACGGCAAGAACACTGCAAGCAATGAAGCTTGCTGTGTC
TTCTTTGCCCTCAGAGACGACCTTCAGAACAATCTTTTCCAAAACGAGTGTGGTGAAGAGGTTCATGAAGTCGTTCGTCTGACTTTCCACGACGCTGTTGGCTTCTCGAACAGCGGTAAA
TTCACCGGAGGTGGCGCGGATGGTTCAATCCTTCTCTTCGGGGACACCGAGACCAACTTCGCCGCTAACAACGGCACCGATGAAGCGGTCGACGATCTCGCACCTTTCCTTCAGACTCAC
AACGTCACTGCAGGTGACCTGATTCAGTTCGGAGCTGCTGTTGGTTTAACGAACTGCCCTGGTGCGCCTCAATTGCAGTTCCTCGCCGGTCGTCCGAATGCCACTGCACCTGCACAGGAC
GGCACCGTCCCGGAGCCTCAGGACAGCGTCGACGACATTCTCGCCCGCTTCTCCGACGTCGGCATCAACTCTGACGAAGTCATTCACCTCCTCGCTAGCCACACTATCGCTCGTTCAGAC
ACGCTCGTCCCGAACCACGATGCAGTACCATTCGACTCGACTCCCTTCACTTTCGACACTCAGATCTTCTTGGAAGTCCTGCTCAAGGGTGTCGGCTTGCCCTTCAACGAGACCAGCAGC
ATTCCAGGCGCTGAAGTCGACTCTCCTATCCCTGACTCGGGCGAAATGCGGCTGCAGTCCGACTTCGCCTTGGCGCGTGACTCGCGCACGGCGTGCGAATGGCAGAGCATGGTTGACAAC
CAGCAGCTTATGATGAACAACTTCCGCTCCGCAATGATGAAGCTCGCAGTTATCGGCCAAGACACTAACAGTCTTGTAGACTGCTCTGAAGTCATCCCAGCCCCCTTGCCTCCTGTCAAC
AAGCCCGCTTCGTTCCCCGCCGGCACCGACCAGACCGACGTCCAGCAGGCATGCACAGCTACGGCGTTCCCAACTCTTAGCGCTGACT
CCGGCCCCGAGACCTCCATCCCTGCCTGCCCT
GATGGCGGCTCTGACGCAGACAACTGCTCTTAA

Retrieve as FASTA