Entry information : FmeMnP15 (GP)
Entry ID 9624
Creation 2011-10-14 (Christophe Dunand)
Last sequence changes 2011-10-14 (Christophe Dunand)
Sequence status complete
Reviewer Nizar Fawal
Last annotation changes 2012-08-24 (Nizar Fawal)
Peroxidase information: FmeMnP15 (GP)
Name (synonym) FmeMnP15 (GP)
Class Manganese peroxidase     [Orthogroup: MnP003]*
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Hymenochaetaceae Fomitiporia
Organism Fomitiporia mediterranea    [TaxId: 208960 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value FmeMnP15
start..stop
S start..stop
FmeMnP02 378 1e-130 11..369 5..358
FmeMnP09 369 2e-127 28..369 20..360
FmeMnP03 369 2e-127 28..369 21..360
FmeMnP11 369 4e-127 28..369 19..357
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 678855..678989 135 N° 2 678716..678785 70 N° 3 678005..678652 648 N° 4 677731..677952 222
N° 5 677635..677669 35  
complement(join(677635..677669,677731..677952,678005..678652,678716..678785,6788 55..678989))


exon

Literature and cross-references FmeMnP15 (GP)
DNA ref. JGI genome:   scaffold_6 (678989..677635)
Protein sequence: FmeMnP15 (GP)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   369 (343)
PWM (Da):   %s   39326.28 (36661.8)  
PI (pH):   %s   5.35 (5.03) Peptide Signal:   %s   cut: 27 range:27-369
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLPISTHTTAAILGLVLSTFVRIASAANYKRVACPGGTHVAVRKECCVFYDLRDDMQENLFENECGDAAHEMLRLTFHDAIGYSQSGQYPGHGADGSIIVFHDTELAFRGNNGIEDAVFSLLPFLSKYNVSAGDIVQFAGAVGLSNCPGSPRLEFLAGRPNATKPTSGDTIPSPADKADALIARLGDAGFSAEELVHLMASHSVARARHIDPTVPRAALDSTPGVFDSQFYLEVLLKGQGYPGNGSGNPFEASSALYSEGGLRFNSDSELARDSRTACTWQSMISNQQLMMNSFQQVMAKLAVTGQDKSKLIDCSDAIPEPKPLSESQDQHTAAYPPGQCVKDVQKSCSSPFPVVPITFGKPSQIPSEP

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTACCCATATCGACACACACGACCGCCGCTATTCTCGGACTCGTCCTGAGTACGTTCGTGCGGATCGCGTCAGCGGCGAACTACAAGCGTGTGGCATGCCCGGGTGGCACGCACGTC
GCCGTTCGCAAGGAG
GTAAGCTGTAACGGAACGAGATCTACACAACATACTAACACCGCCGATGATTTTTTGGAATTAATGTAGTGCTGTGTGTTTTATGACCTGAGGGACGATATGCAG
GAAAACCTGTTTGAGAATGAATGTGGGGATGCAG
GTACAACCGCCACACGAGTTCAGCGTACTTGATGAGGAGTGCTGACATGTTGAACTTTCGTAGCACATGAAATGCTCAGACTCACT
TTTCACGATGCAATTGGGTACTCACAGTCTGGACAATACCCAGGACATGGTGCAGACGGCTCGATCATAGTGTTCCATGACACTGAACTGGCATTTCGCGGTAACAACGGCATCGAAGAT
GCCGTATTCTCACTCTTGCCGTTCCTCTCCAAGTACAATGTCTCTGCGGGAGACATTGTACAATTCGCAGGCGCAGTCGGACTTTCCAACTGTCCCGGTTCTCCTCGGTTAGAATTCTTA
GCAGGAAGACCAAACGCAACCAAACCCACAAGCGGAGATACAATCCCTTCGCCGGCGGATAAAGCAGATGCACTCATCGCACGTCTAGGAGACGCAGGTTTCTCCGCAGAAGAACTCGTG
CACCTCATGGCGAGCCACTCAGTTGCAAGGGCTAGGCATATTGACCCGACTGTCCCACGGGCAGCACTAGATTCCACTCCTGGGGTTTTCGATTCTCAGTTCTACCTTGAGGTACTACTG
AAAGGCCAAGGGTATCCCGGAAACGGAAGTGGGAACCCGTTCGAGGCATCCTCGGCTTTGTATAGCGAAGGAGGGCTGCGTTTTAATTCCGACTCTGAGCTAGCACGAGATAGTCGAACG
GCGTGCACATGGCAGTCCATGATCA
GTATGTATCAGGCCGTTACCGGTATACTAAGTCGCTAATTGTGAAACTGCAGGCAACCAACAGCTTATGATGAATAGCTTCCAACAAGTAATGGC
AAAGCTCGCTGTCACAGGCCAGGACAAGTCAAAGCTTATTGACTGCTCTGACGCTATTCCAGAACCAAAACCTCTCTCGGAAAGCCAGGATCAACATACTGCTGCATACCCTCCAGGGCA
ATGCGTAAAAGACGTGCAGAAATCTTGTTCATCACCATTCCCTGTTGTTCCTATAACAT
GTAGGTTTCATTACGCCACTTTGCTGAATCTGTTTACCTTTCTTATATAATTGCGTTACAG

TCGGCAAGCCATCCCAGATTCCGTCTGAGCCATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTACCCATATCGACACACACGACCGCCGCTATTCTCGGACTCGTCCTGAGTACGTTCGTGCGGATCGCGTCAGCGGCGAACTACAAGCGTGTGGCATGCCCGGGTGGCACGCACGTC
GCCGTTCGCAAGGAG
TGCTGTGTGTTTTATGACCTGAGGGACGATATGCAGGAAAACCTGTTTGAGAATGAATGTGGGGATGCAGCACATGAAATGCTCAGACTCACTTTTCACGATGCA
ATTGGGTACTCACAGTCTGGACAATACCCAGGACATGGTGCAGACGGCTCGATCATAGTGTTCCATGACACTGAACTGGCATTTCGCGGTAACAACGGCATCGAAGATGCCGTATTCTCA
CTCTTGCCGTTCCTCTCCAAGTACAATGTCTCTGCGGGAGACATTGTACAATTCGCAGGCGCAGTCGGACTTTCCAACTGTCCCGGTTCTCCTCGGTTAGAATTCTTAGCAGGAAGACCA
AACGCAACCAAACCCACAAGCGGAGATACAATCCCTTCGCCGGCGGATAAAGCAGATGCACTCATCGCACGTCTAGGAGACGCAGGTTTCTCCGCAGAAGAACTCGTGCACCTCATGGCG
AGCCACTCAGTTGCAAGGGCTAGGCATATTGACCCGACTGTCCCACGGGCAGCACTAGATTCCACTCCTGGGGTTTTCGATTCTCAGTTCTACCTTGAGGTACTACTGAAAGGCCAAGGG
TATCCCGGAAACGGAAGTGGGAACCCGTTCGAGGCATCCTCGGCTTTGTATAGCGAAGGAGGGCTGCGTTTTAATTCCGACTCTGAGCTAGCACGAGATAGTCGAACGGCGTGCACATGG
CAGTCCATGATCA
GCAACCAACAGCTTATGATGAATAGCTTCCAACAAGTAATGGCAAAGCTCGCTGTCACAGGCCAGGACAAGTCAAAGCTTATTGACTGCTCTGACGCTATTCCAGAA
CCAAAACCTCTCTCGGAAAGCCAGGATCAACATACTGCTGCATACCCTCCAGGGCAATGCGTAAAAGACGTGCAGAAATCTTGTTCATCACCATTCCCTGTTGTTCCTATAACAT
TCGGC
AAGCCATCCCAGATTCCGTCTGAGCCATAA

Retrieve as FASTA