Entry information : PbreCIIBB08 (MnP8-short)
Entry ID 9628
Creation 2011-10-24 (Christophe Dunand)
Last sequence changes 2011-10-24 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-12-04 (Christophe Dunand)
Peroxidase information: PbreCIIBB08 (MnP8-short)
Name (synonym) PbreCIIBB08 (MnP8-short)
Class Other class II peroxidase type B    [Orthogroup: CIIBB001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Phlebia
Organism Phlebia brevispora    [TaxId: 194682 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PbreCIIBB08
start..stop
S start..stop
TvCIIBB15_KN9522 460 1.81e-163 1..362 1..361
TvCIIBB03 459 3.24e-163 1..362 1..361
PcriCIIBB07 451 1e-159 1..362 1..356
PoVP04_PC15 451 1.18e-159 1..362 1..354
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '9628' 'join(543837..543897,543953..544260,544363..544400,544452..544519,544567..544696,544748..544989,545050..545297)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 543837..543897 59 N° 2 543953..544260 306 N° 3 544363..544400 36 N° 4 544452..544519 66
N° 5 544567..544696 128 N° 6 544748..544989 240 N° 7 545050..545297 246  
join(543837..543897,543953..544260,544363..544400,544452..544519,544567..544696, 544748..544989,545050..545297)


exon

Literature and cross-references PbreCIIBB08 (MnP8-short)
DNA ref. JGI genome:   scaffold_6 (543837..545297)
Protein sequence: PbreCIIBB08 (MnP8-short)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   364 (340)
PWM (Da):   %s   38243.71 (35663.3)  
PI (pH):   %s   3.96 (3.92) Peptide Signal:   %s   cut: 25 range:25-364
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MFFSTVRAVYCAVLILQVVQAAVALQFICPDGVHTASHLSCCNLY
PVLEDIQTNLFGGGQCDEAAHESLRLTFHDAIAFSPSLTRQGKWGGGGADGSVLVFDAIETAYDANDGIADIVRCSP
TYVAKHNISPGDFVQFAGAVGVSNCPGAPQLQFLGRPPPILPAPDGLVPEPFDNVTSILNRFADAGFSSEEVIALLASHSVASSNDIDPTIAGAPFDSTP
YTFDSQVFVEVQLQGILWPGTADNEGEVLSPLEGEVRLQSDHDLARDPRTACSWQSF
NNQTKMQTEFAAAMAKLAVVGQDTSLLVDCSEVIPIPGDFTGSAYLPAGKTMDDIEQACDTSP
FPSLTADAGPATSIPPVSQ

Retrieve as FASTA  
Remarks Complete sequence from genomic (8 introns). Incorrect prediction from JGI (first exon is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTCTTCAGCACCGTCCGTGCCGTGTACTGCGCGGTGCTTATCCTCCAAGTGGTTCAGGGGGTAGGTAATGATGTAGCGTCTTTCCTAATCTACACCACTGACGACAAAGGCATAGCC
GCAGTCGCCCTGCAATTCATCTGTCCCGACGGAGTACACACCGCAAGCCATTTGTCCTGCTGTAACCTCTATCCTGTCCTCGAAGACATTCAAACGAACCTTTTTGGAGGCGGTCAGTGT
GACGAGGCAGCACATGAGTCGCTGCGTCTTACATTTCATGACGCTATTGCCTTCTCGCCTTCCCTGACGCGCCAAGGAAAATGGGGTGGTGGTGGCGCGGACGGCTCCGTTCTTGTCTTC
GACGCTATCGAAACCGCATACGATGCCAACGATGGTATTGCTGATATTGTACGTTGTTCTCCGATT
TTGTTATAGTGTCTTCGCTCAATTTTTTTCTTGCAGGTCAAGCAGCAAAAGGTA
TCCTCGAGAATCACGGCGACGCCCATTGTCACTCATTTGATGATTCTTAGACCTACGTTGCAAAGCATAACATCAGTCCTGGCGACTTTTGTAAGCAGTATTCTGTCAGTACTTTCTGTT
TCACTCATCAATGTGTCCTAGTGTCCAGTTTGCCGGTGCTGTGGGCGTTAGTAATTGCCCTGGCGCTCCGCAATTGCAATTCCTACTAGAGGTAGGTTCAACTGGTATGTAATTTTGTAT
CCATCTAAGTTATCCCAGGTCGTCCGCCGCCCATTCTACCAGCCCCAGATGGGCTTGTTCCCGAGCCATTCGACAATGTCACTAGTATCCTTAATCGCTTTGCCGATGCCGGGTTTAGTT
CCGAAGAAGTGATTGCTCTGCTAGCTTC
TCGTATGTGAAATGTTCTTCGTCTTCTAGGCATGTCTCAAGTGTATCTCTCAGGCATTCAGTGGCGTCTTCCAACGATATTGACCCTACAAT
AGCTGGCGCTCCCTTCGATTCTACGCCGTACACGTTTGACTCACAGGTCTTTGTGGAAGTTCAGCTGCAAGGAATACTTTGGCCGGGTACGGCAGACAACGAAGGCGAGGTTCTATCTCC
CCTTGAAGGCGAGGTGCGCTTGCAGTCGGACCACGATCTCGCGCGCGATCCACGCACCGCCTGTTCGTGGCAGTCGTTCGTCA
CAGTAAGTGAAGTCCTCTTTTCGCTCTTTCATTTCCT
TGCATACTGATAGCGCGTCTTCTAGACAATCAAACAAAGATGCAGACCGAATTCGCGGCCGCCATGGCGAAGCTAGCCGTCGTCGGTCAAGACACCAGCTTGTTGGTCGATTGCTCTGAG
GTTATCCCCATTCCCGGCGATTTCACAGGATCTGCATATCTGCCGGCTGGCAAAACGATGGATGATATTGAGCAAGCATGCGATACCTCACCCTTTCCTAGTTTGACCGCAGACGCGGGA
CCTGCTACTTCTATTCCGCCCGTAAGTCAATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTCTTCAGCACCGTCCGTGCCGTGTACTGCGCGGTGCTTATCCTCCAAGTGGTTCAGGCCGCAGTCGCCCTGCAATTCATCTGTCCCGACGGAGTACACACCGCAAGCCATTTGTCC
TGCTGTAACCTCTATCCTGTCCTCGAAGACATTCAAACGAACCTTTTTGGAGGCGGTCAGTGTGACGAGGCAGCACATGAGTCGCTGCGTCTTACATTTCATGACGCTATTGCCTTCTCG
CCTTCCCTGACGCGCCAAGGAAAATGGGGTGGTGGTGGCGCGGACGGCTCCGTTCTTGTCTTCGACGCTATCGAAACCGCATACGATGCCAACGATGGTATTGCTGATATTGTACGTTGT
TCTCCGATT
ACCTACGTTGCAAAGCATAACATCAGTCCTGGCGACTTTGTCCAGTTTGCCGGTGCTGTGGGCGTTAGTAATTGCCCTGGCGCTCCGCAATTGCAATTCCTACTAGGTCGT
CCGCCGCCCATTCTACCAGCCCCAGATGGGCTTGTTCCCGAGCCATTCGACAATGTCACTAGTATCCTTAATCGCTTTGCCGATGCCGGGTTTAGTTCCGAAGAAGTGATTGCTCTGCTA
GCTTC
GCATTCAGTGGCGTCTTCCAACGATATTGACCCTACAATAGCTGGCGCTCCCTTCGATTCTACGCCGTACACGTTTGACTCACAGGTCTTTGTGGAAGTTCAGCTGCAAGGAATA
CTTTGGCCGGGTACGGCAGACAACGAAGGCGAGGTTCTATCTCCCCTTGAAGGCGAGGTGCGCTTGCAGTCGGACCACGATCTCGCGCGCGATCCACGCACCGCCTGTTCGTGGCAGTCG
TTCGTCA
ACAATCAAACAAAGATGCAGACCGAATTCGCGGCCGCCATGGCGAAGCTAGCCGTCGTCGGTCAAGACACCAGCTTGTTGGTCGATTGCTCTGAGGTTATCCCCATTCCCGGC
GATTTCACAGGATCTGCATATCTGCCGGCTGGCAAAACGATGGATGATATTGAGCAAGCATGCGATACCTCACCCTTTCCTAGTTTGACCGCAGACGCGGGACCTGCTACTTCTATTCCG
CCCGTAAGTCAATGA

Retrieve as FASTA