Entry information : PbreMnP01 (MnP1-long)
Entry ID 9637
Creation 2011-11-01 (Christophe Dunand)
Last sequence changes 2012-03-29 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-11-04 (Christophe Dunand)
Peroxidase information: PbreMnP01 (MnP1-long)
Name (synonym) PbreMnP01 (MnP1-long)
Class Manganese peroxidase    [Orthogroup: MnP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Phlebia
Organism Phlebia brevispora    [TaxId: 194682 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PbreMnP01
start..stop
S start..stop
PbreMnP04 704 0 1..381 1..381
PbreMnP03 692 0 1..383 1..383
PbreMnP07 677 0 1..383 1..383
PbreMnP05 653 0 1..382 1..382
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '9637' 'complement(join(1699119..1699210,1699266..1699342,1699406..1699541,1699606..1699759,1699816..1699863,1699936..1700157,1700218..1700395,1700455..1700494,1700557..1700583,1700643..1700694,1700752..1700877))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1700752..1700877 124 N° 2 1700643..1700694 50 N° 3 1700557..1700583 25 N° 4 1700455..1700494 38
N° 5 1700218..1700395 176 N° 6 1699936..1700157 220 N° 7 1699816..1699863 46 N° 8 1699606..1699759 152
N° 9 1699406..1699541 134 N° 10 1699266..1699342 75 N° 11 1699119..1699210 90  
complement(join(1699119..1699210,1699266..1699342,1699406..1699541,1699606..1699 759,1699816..1699863,1699936..1700157,1700218..1700395,1700455..1700494,1700557. .1700583,1700643..1700694,1700752..1700877))


exon

Literature and cross-references PbreMnP01 (MnP1-long)
DNA ref. JGI genome:   scaffold_2 (1700877..1699119)
Protein sequence: PbreMnP01 (MnP1-long)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   383 (365)
PWM (Da):   %s   40634.05 (38865.1)  
PI (pH):   %s   4.55 (4.55) Peptide Signal:   %s   cut: 19 range:19-383
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFTSLFALVALAAYAGAKPARPTFCSDGTRVTNEACCAFIPLAQDLQKTIFQNDCGEDAHEVIRLTFHDAVAISQRQGPRAGGGADGSMLLFPLVEPEFSANNGIDDSVNNLIPFMARHPTISAGDIVQFAGAVALSNCGAPQLEFLAGRPNRTIAAVDGL
IPEPQDSVTKILERFADAGNFSPFEVVSLLASHSIARADKVDETIDAAPFDS
TPFTFDSQIFLEVLLKGVGFPGTDNNTGEVASPLPKGSGSDTGEMRLQSDFALARDERTACFWQSFVN
EEEFMASSFKAAMAKLAVLGHNRNDLIDCSDVVPTPKPAVRKAA
SFPATKSARDLELTCRTLRFPTLTTRGATETLIPHCSDGAMNCTTVQFSGPATDT

Retrieve as FASTA  
Remarks Complete sequence from genomic (10 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCACCTCTCTCTTCGCACTTGTTGCTCTAGCGGCATACGCTGGTGCCAAGCCTGCTCGCCCCACCTTCTGCTCTGACGGTACTCGCGTCACTAACGAGGCATGCTGCGCTTTC
ATCCCG
GTACGTATCACGGCCCGCTGTCGATCTTGCCATCACTCGCTGACCTATGACTCTAAGCTCTTGCTCAAGATCTCCAGAAGACAATTTTTCAGAATGATTGTGGTGAAGATGGTA
AAAACCAGGGTTTTTGCCACATCGGTGTCCTTTGACGCTGACGAATCTATCTGCAGCACACATGAAGTCATCCGACTGACTTTCCGTAAGCATCTTGCGAAACCGAGTCGGTATAAGATG
ATATTAACAATATTCTGGAACATCTAGACACGATGCCGTTGCTATTAGTCAACGTCAAGGTCCTAGAGCGTGAGTGCCTTCGCAGTCTACTCGTACATCACAACTGAAAGAGCTATGATG
ATGACCAGTGTGGCGGAGGTGCTGATGGATCCATGCTCCTGTTCCCCCTCGTTGAGCCTGAGTTCTCCGCCAACAATGGTATTGACGACAGTGTGAACAATTTGATCCCCTTTATGGCCA
GACACCCGACAATTAGCGCAGGGGACATTGTTCAGTTCGCCGGTGCGGTAGCGCTGAGCAACTGCCCT
GTAAGTTCCGTTTCTGTTCGTGATTTCCATCGTGGCGCTGATATGTGTTGAC
GACTGCAGGGGGAGCGCCGCAGCTCGAATTCTTAGCTGGTCGCCCGAACAGGACGATCGCGGCCGTCGATGGTCTGATTCCCGAGCCCCAGGACAGCGTGACGAAGATTCTCGAGCGCTT
TGCTGACGCAGGCAACTTCTCGCCATTTGAGGTTGTCTCTCTGCTGGCTTCACACAGTATTGCACGCGCTGACAAGGTTGATGAAACGATTGACGCCGCACCCTTCGATTCG
GTTAGTTC
GATATACCACTTCATTCCGTGCTGACTAGAGCTCAGGCTGACGACATGTGCCGAACATGAATAGACACTCCTTTCACGTTCGACAGCCAGATCTTCCTGGAGGTGCTGCTGAAGGTAAAC
ATTGCCCGAGTATAGCTTCGAGAAACATAGCCTGATGCATGTGCGTATAGGGGGCGTCGGATTTCCCGGAACGGACAACAACACCGGCGAGGTCGCGTCTCCGCTCCCGAAAGGCTCTGG
CAGTGACACTGGCGAAATGCGTCTCCAATCCGACTTTGCTCTCGCTCGTGATGAGCGCACGGCATGCTTCTGGCAAAGTTTCGTCA
GTACGTTCAACCATCCTTTGTTTAGCTTGTGTCC
CATTTCTTACGTCGTACCCTACCTTTGTAGATATGAGGAGGAGTTCATGGCGTCGAGCTTCAAGGCTGCGATGGCGAAGCTTGCCGTCCTCGGACATAACAGGAATGACCTGATTGACTG
CTCCGACGTTGTCCCCACGCCCAAACCTGCCGTGAGGAAGGCCGCGTC
GTACGTACTGTATACCCATACGGACGCAAACTGCTTTGTTGATCCCAGAATTTTACGATGTAGATATTCCCG
GCAACTAAGAGCGCGAGGGACCTGGAGCTCACGTGCAGAACCTTAAGATTCCCGACACTCACCACTGACC
GTAAGTCCTTGCTACTTCAAGTTCCGCGTCATAACTAACCTGAGACCCCT
CACAGGCGCGGTGCTACCGAGACTCTCATCCCGCACTGCTCTGACGGCGCTATGAACTGCACTACTGTCCAATTCTCTGGCCCCGCCACGGACACTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCACCTCTCTCTTCGCACTTGTTGCTCTAGCGGCATACGCTGGTGCCAAGCCTGCTCGCCCCACCTTCTGCTCTGACGGTACTCGCGTCACTAACGAGGCATGCTGCGCTTTC
ATCCCG
CTTGCTCAAGATCTCCAGAAGACAATTTTTCAGAATGATTGTGGTGAAGATGCACATGAAGTCATCCGACTGACTTTCCACGATGCCGTTGCTATTAGTCAACGTCAAGGTCCT
AGAGC
TGGCGGAGGTGCTGATGGATCCATGCTCCTGTTCCCCCTCGTTGAGCCTGAGTTCTCCGCCAACAATGGTATTGACGACAGTGTGAACAATTTGATCCCCTTTATGGCCAGACAC
CCGACAATTAGCGCAGGGGACATTGTTCAGTTCGCCGGTGCGGTAGCGCTGAGCAACTGCCCT
GGAGCGCCGCAGCTCGAATTCTTAGCTGGTCGCCCGAACAGGACGATCGCGGCCGTC
GATGGTCTGATTCCCGAGCCCCAGGACAGCGTGACGAAGATTCTCGAGCGCTTTGCTGACGCAGGCAACTTCTCGCCATTTGAGGTTGTCTCTCTGCTGGCTTCACACAGTATTGCACGC
GCTGACAAGGTTGATGAAACGATTGACGCCGCACCCTTCGATTCG
ACTCCTTTCACGTTCGACAGCCAGATCTTCCTGGAGGTGCTGCTGAAGGGCGTCGGATTTCCCGGAACGGACAAC
AACACCGGCGAGGTCGCGTCTCCGCTCCCGAAAGGCTCTGGCAGTGACACTGGCGAAATGCGTCTCCAATCCGACTTTGCTCTCGCTCGTGATGAGCGCACGGCATGCTTCTGGCAAAGT
TTCGTCA
ATGAGGAGGAGTTCATGGCGTCGAGCTTCAAGGCTGCGATGGCGAAGCTTGCCGTCCTCGGACATAACAGGAATGACCTGATTGACTGCTCCGACGTTGTCCCCACGCCCAAA
CCTGCCGTGAGGAAGGCCGCGTC
ATTCCCGGCAACTAAGAGCGCGAGGGACCTGGAGCTCACGTGCAGAACCTTAAGATTCCCGACACTCACCACTGACCGCGGTGCTACCGAGACTCTC
ATCCCGCACTGCTCTGACGGCGCTATGAACTGCACTACTGTCCAATTCTCTGGCCCCGCCACGGACACTTAG

Retrieve as FASTA