Entry information : PbreMnP02 (MnP2-long)
Entry ID 9638
Creation 2011-11-01 (Christophe Dunand)
Last sequence changes 2011-11-14 (Christophe Dunand)
Sequence status partial
Reviewer Nizar Fawal
Last annotation changes 2012-08-22 (Nizar Fawal)
Peroxidase information: PbreMnP02 (MnP2-long)
Name (synonym) PbreMnP02 (MnP2-long)
Class Manganese peroxidase     [Orthogroup: MnP001]*
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Phlebia
Organism Phlebia brevispora    [TaxId: 194682 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PbreMnP02
start..stop
S start..stop
PbreMnP07 286 2e-98 1..140 245..384
PbreMnP03 283 3e-97 1..140 245..384
PbreMnP04 251 1e-84 1..139 245..383
PbreMnP01 242 4e-81 1..139 245..383
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2199841..2199955 115 N° 2 2200013..2200148 136 N° 3 2200204..2200280 77 N° 4 2200336..2200430 95
join(2199841..2199955,2200013..2200148,2200204..2200280,2200336..2200430)


exon

Literature and cross-references PbreMnP02 (MnP2-long)
DNA ref. JGI genome:   scaffold_2 (2199841..2200430)
Protein sequence: PbreMnP02 (MnP2-long)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   140
PWM (Da):   %s   14804.17  
PI (pH):   %s   4.3
Sequence 181
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
VASPLPLTSGTDTGELRLQSDFALARDERTACFWQSFVNEEEFMATSFKNAMAKLAVLGHNTNDLIDCSDVVPAPKAAVKKPATFPATKNASDLELTCTALRFPTLTTDPGATETLIPHCSDGNMTCVTVQFDGPATDSS

Retrieve as FASTA  
Remarks Partials sequence from genomic. Large 5'end is missing => undetermined sequence)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTGCGTCTCCGCTCCCTCTGACCAGCGGCACCGACACTGGCGAGTTGCGTCTCCAGTCCGACTTCGCTCTCGCTCGTGACGAACGCACTGCCTGCTTCTGGCAGAGTTTCGTCAGTACGT
GTCATCCCCCCTTCTTTGTCTGCCTCACATTACTCACGCAACATCTTCCAGACGAGGAGGAGTTCATGGCTACGAGCTTCAAGAACGCCATGGCGAAGTTGGCTGTCCTCGGCCACAACA
CGAACGACCTGATTGACTGCTCTGACGTCGTCCCCGCGCCCAAGGCCGCTGTCAAGAAGCCGGCCAC
GTAAGTAATATTGTTAAAGGCAAGCTTAAAGCTGCGTGATTGACCACAAACAT
AGATTCCCGGCCACCAAGAACGCCAGTGACCTTGAGCTGACCTGCACTGCCTTGAGGTTCCCCACGCTCACCACTGATCGTAAGTTTTCTCATTGCTGCATCAGTCTTCTTCGTGATCAT
TGACTCTTTCACAGCTGGTGCCACCGAGACCCTCATCCCTCACTGCTCTGACGGCAACATGACCTGTGTTACTGTGCAGTTCGACGGCCCCGCCACGGACTCCTCGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTGCGTCTCCGCTCCCTCTGACCAGCGGCACCGACACTGGCGAGTTGCGTCTCCAGTCCGACTTCGCTCTCGCTCGTGACGAACGCACTGCCTGCTTCTGGCAGAGTTTCGTCAACGAGG
AGGAGTTCATGGCTACGAGCTTCAAGAACGCCATGGCGAAGTTGGCTGTCCTCGGCCACAACACGAACGACCTGATTGACTGCTCTGACGTCGTCCCCGCGCCCAAGGCCGCTGTCAAGA
AGCCGGCCAC
ATTCCCGGCCACCAAGAACGCCAGTGACCTTGAGCTGACCTGCACTGCCTTGAGGTTCCCCACGCTCACCACTGATCCTGGTGCCACCGAGACCCTCATCCCTCACTGCT
CTGACGGCAACATGACCTGTGTTACTGTGCAGTTCGACGGCCCCGCCACGGACTCCTCGTGA

Retrieve as FASTA