Entry information : PbreMnP03 (MnP3-long)
Entry ID 9642
Creation 2011-11-01 (Christophe Dunand)
Last sequence changes 2012-12-04 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-12-04 (Christophe Dunand)
Peroxidase information: PbreMnP03 (MnP3-long)
Name (synonym) PbreMnP03 (MnP3-long)
Class Manganese peroxidase    [Orthogroup: MnP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Phlebia
Organism Phlebia brevispora    [TaxId: 194682 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PbreMnP03
start..stop
S start..stop
PbreMnP07 744 0 1..384 1..384
PbreMnP04 704 0 1..383 1..383
PbreMnP01 692 0 1..383 1..383
PbreMnP05 638 0 1..382 1..382
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2233202..2233327 126 N° 2 2233093..2233144 52 N° 3 2233005..2233031 27 N° 4 2232909..2232948 40
N° 5 2232673..2232850 178 N° 6 2232393..2232614 222 N° 7 2232276..2232323 48 N° 8 2232063..2232216 154
N° 9 2231870..2232005 136 N° 10 2231738..2231814 77 N° 11 2231594..2231688 95  
complement(join(2231594..2231688,2231738..2231814,2231870..2232005,2232063..2232 216,2232276..2232323,2232393..2232614,2232673..2232850,2232909..2232948,2233005. .2233031,2233093..2233144,2233202..2233327))


exon

Literature and cross-references PbreMnP03 (MnP3-long)
DNA ref. JGI genome:   scaffold_1518 (1387..1) [5' end]   scaffold_2 (2232215..2231593) [3' end]
Protein sequence: PbreMnP03 (MnP3-long)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   384 (366)
PWM (Da):   %s   40306.86 (38527.9)  
PI (pH):   %s   4.13 (4.13) Peptide Signal:   %s   cut: 19 range:19-384
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFTSLIALVALAAYATASPARPAVCSDGTRVTNEACCAFIPLAQDLQSEVLQNDCGEDAHEIIRLTFHDAIAISRSQGPKAGGGADGSMLLFPLVEPEFSANNGISDSVNNLIPFMAKHPTISAGDIVQFAGAVALTNCGAPQLEFLAGRPNKTIPAVDGLIPEPQDSVTKILERFEDAGGFTPFEVVSLLASHSIARADKVDETIDAAPFDSTPFTFDTQVFLEVLLKGTGFPGTDNNTGEVASPLPLTSGTDTGELRLQSDFALARDERTACFWQGFVNEEEFMATSFKNAMAKLAVLGHNTNDLIDCSDVVPAPKAAVKKPATFPATKNASDLELTCTALRFPTLTTPGATETLIPHCSDGDMTCVTVQFDGPATDSS

Retrieve as FASTA  
Remarks Complete sequence from genomic (10 introns). Sequence has bee reconstructed from scaffold_2 (short 3'end due to undetermined sequence) and scaffold_1518 (5' end => BAC end). Overlap between the two scaffolds.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCACCTCTCTCATCGCACTCGTCGCTCTTGCGGCATACGCTACTGCGTCCCCCGCACGCCCCGCTGTCTGCTCTGATGGCACTCGTGTCACGAATGAGGCCTGCTGCGCTTTC
ATTCCT
GTACGTACCACAGCCGACATCGATGCTGCCCACCCTTCCTGACGCAGATGTTTTCAGCTTGCCCAGGACCTCCAGTCAGAAGTTCTCCAGAACGACTGCGGTGAAGATGGTGAG
GAGCATTGCTTAGGGTGTATCACTCTGTACCAGCGCGCTGAATACCGCATTCCTAGCCCACGAGATCATTCGGTTGACTTTCCGTAAGTCCACTTACAAGTTGAAGTTGCATGAACTAAT
GCCACTCTACCTCGTTCAGACGATGCCATTGCCATCAGTCGGAGCCAGGGCCCTAAGGCGTGAGTGTTTCTTTTCCAACTCATAGACCTGATTTTACTGGAGAGCTGCGATGATTAGCGG
TGGAGGTGCTGATGGCTCCATGCTCCTCTTCCCCCTCGTCGAGCCCGAGTTTTCGGCCAACAACGGCATTTCCGACAGTGTCAACAACTTGATCCCCTTCATGGCCAAGCACCCGACGAT
CAGCGCTGGTGACATCGTTCAGTTTGCCGGCGCCGTAGCGCTGACCAACTGCCCC
GTAAGCGCCGTTTCTGTGTTCGACATAGCTGCGTTGTTCTAACGCACGCTGGCGACAGGGAGCGC
CCCAGCTTGAATTCCTTGCTGGCCGCCCGAACAAGACGATTCCAGCTGTTGATGGCCTGATCCCAGAGCCGCAGGACAGCGTGACCAAGATTCTCGAGCGCTTTGAGGATGCAGGCGGCT
TCACGCCCTTCGAGGTGGTCTCTTTGTTGGCTTCGCACAGTATCGCGCGTGCCGATAAGGTCGACGAAACGATCGATGCCGCACCCTTCGATTCG
GTCAGTTCGACATCCTGCATCTCGT
CTCCATTCGACCTAAAACTAACATCATGTCTCGAACTTTAACAGACTCCATTCACGTTTGACACCCAGGTCTTCCTTGAAGTTCTGCTCAAGGTAAAGTACTACTACATGTGACGTCGGA
AATCGTACGTTAATCATCATGCTCGTCTCAGGGCACCGGGTTCCCTGGAACGGACAACAACACTGGCGAGGTTGCGTCTCCGCTCCCTCTGACCAGCGGCACCGACACTGGCGAGTTGCG
TCTCCAGTCCGACTTCGCTCTCGCTCGTGACGAACGCACTGCCTGCTTCTGGCAGGGTTTCGTCA
GTACGTGTCATCCCTCCTTCTTTGTCTGCCTCACATTACTCACGCAACATCTTCC
AGACGAGGAGGAGTTCATGGCTACGAGCTTCAAGAACGCCATGGCGAAGTTGGCTGTCCTCGGCCACAACACGAACGACCTGATTGACTGCTCTGACGTCGTCCCCGCGCCCAAGGCCGC
TGTCAAGAAGCCGGCCAC
GTAAGTAATATTGTTAGAGGCAAGCTTAAAGCTGCGTGATTGACCACAAACATAGATTCCCGGCCACCAAGAACGCCAGTGACCTTGAGCTGACCTGCACTG
CCTTGAGGTTCCCCACACTCACCACCGATC
GTAAGTTTTCTCCTTGCTGCATTCTTCGCGATCGTTAACCCTCTCGCAGCCGGTGCCACCGAGACTCTCATTCCTCACTGCTCTGATGGC
GACATGACCTGCGTAACTGTGCAGTTCGACGGTCCTGCCACCGATTCCTCGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCACCTCTCTCATCGCACTCGTCGCTCTTGCGGCATACGCTACTGCGTCCCCCGCACGCCCCGCTGTCTGCTCTGATGGCACTCGTGTCACGAATGAGGCCTGCTGCGCTTTC
ATTCCT
CTTGCCCAGGACCTCCAGTCAGAAGTTCTCCAGAACGACTGCGGTGAAGATGCCCACGAGATCATTCGGTTGACTTTCCACGATGCCATTGCCATCAGTCGGAGCCAGGGCCCT
AAGGC
CGGTGGAGGTGCTGATGGCTCCATGCTCCTCTTCCCCCTCGTCGAGCCCGAGTTTTCGGCCAACAACGGCATTTCCGACAGTGTCAACAACTTGATCCCCTTCATGGCCAAGCAC
CCGACGATCAGCGCTGGTGACATCGTTCAGTTTGCCGGCGCCGTAGCGCTGACCAACTGCCCC
GGAGCGCCCCAGCTTGAATTCCTTGCTGGCCGCCCGAACAAGACGATTCCAGCTGTT
GATGGCCTGATCCCAGAGCCGCAGGACAGCGTGACCAAGATTCTCGAGCGCTTTGAGGATGCAGGCGGCTTCACGCCCTTCGAGGTGGTCTCTTTGTTGGCTTCGCACAGTATCGCGCGT
GCCGATAAGGTCGACGAAACGATCGATGCCGCACCCTTCGATTCG
ACTCCATTCACGTTTGACACCCAGGTCTTCCTTGAAGTTCTGCTCAAGGGCACCGGGTTCCCTGGAACGGACAAC
AACACTGGCGAGGTTGCGTCTCCGCTCCCTCTGACCAGCGGCACCGACACTGGCGAGTTGCGTCTCCAGTCCGACTTCGCTCTCGCTCGTGACGAACGCACTGCCTGCTTCTGGCAGGGT
TTCGTCA
ACGAGGAGGAGTTCATGGCTACGAGCTTCAAGAACGCCATGGCGAAGTTGGCTGTCCTCGGCCACAACACGAACGACCTGATTGACTGCTCTGACGTCGTCCCCGCGCCCAAG
GCCGCTGTCAAGAAGCCGGCCAC
ATTCCCGGCCACCAAGAACGCCAGTGACCTTGAGCTGACCTGCACTGCCTTGAGGTTCCCCACACTCACCACCGATCCCGGTGCCACCGAGACTCTC
ATTCCTCACTGCTCTGATGGCGACATGACCTGCGTAACTGTGCAGTTCGACGGTCCTGCCACCGATTCCTCGTAA

Retrieve as FASTA