Entry information : PbreMnP07 (MnP7-long / MnP2-long)
Entry ID 9643
Creation 2011-11-01 (Christophe Dunand)
Last sequence changes 2012-12-04 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-12-04 (Christophe Dunand)
Peroxidase information: PbreMnP07 (MnP7-long / MnP2-long)
Name (synonym) PbreMnP07 (MnP7-long / MnP2-long)
Class Manganese peroxidase    [Orthogroup: MnP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Phlebia
Organism Phlebia brevispora    [TaxId: 194682 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PbreMnP07
start..stop
S start..stop
PbreMnP03 744 0 1..384 1..384
PbreMnP04 691 0 1..383 1..383
PbreMnP01 677 0 1..383 1..383
PbreMnP05 644 0 1..382 1..382
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2198693..2198818 126 N° 2 2198880..2198931 52 N° 3 2198993..2199019 27 N° 4 2199076..2199115 40
N° 5 2199173..2199350 178 N° 6 2199412..2199633 222 N° 7 2199694..2199741 48 N° 8 2199801..2199954 154
N° 9 2200012..2200147 136 N° 10 2200203..2200279 77 N° 11 2200335..2200429 95  
join(2198693..2198818,2198880..2198931,2198993..2199019,2199076..2199115,2199173 ..2199350,2199412..2199633,2199694..2199741,2199801..2199954,2200012..2200147,22 00203..2200279,2200335..2200429)


exon

Literature and cross-references PbreMnP07 (MnP7-long / MnP2-long)
DNA ref. JGI genome:   scaffold_553 (1949..3212) [5' end]   scaffold_2 (2199841..2200430) [3' end]
Protein sequence: PbreMnP07 (MnP7-long / MnP2-long)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   384 (366)
PWM (Da):   %s   40208.83 (38367.9)  
PI (pH):   %s   4.08 (4.08) Peptide Signal:   %s   cut: 19 range:19-384
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFTSLFALVALVAYTAASPAPAAVCSDGTRVSNEACCAFIPLAQDLQSEVLQNDCGEDAHEIIRLTFHDAIAISRSKGPSAGGGADGSMLLFPLVEPEFVANNGISDSVNNLIPFLAKHPTISAGDLVQFAGAVALTNCGAPQLEFLAGRPNKTIPAIDGLIPEPQDSVTSILERFDDAGGFTPFEVVSLLASHSIARADKVDETIDAAPFDSTPFTFDTQVFLEVLLKGVGFPGTDNNTGEVASPLPLTSGTDTGELRLQSDFALARDERTACFWQSFVNEEEFMATSFKNAMAKLAVLGHNTNDLIDCSDVVPAPKAAVKKPATFPATKNASDLELTCTALRFPTLTTPGATETLIPHCSDGNMTCVTVQFDGPATDSS

Retrieve as FASTA  
Remarks Complete sequence from genomic (10 introns). Sequence has bee reconstructed from scaffold_2 (short 3'end due to undetermined sequence) and scaffold_553 (5' end => BAC end). Overlap between the two scaffold
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTTACTTCGCTCTTCGCACTCGTCGCTTTAGTAGCGTACACCGCTGCCTCACCCGCACCCGCTGCCGTCTGCTCTGACGGCACTCGCGTCTCCAACGAGGCTTGCTGCGCTTTC
ATTCCT
GTACGTAATGCAGCCGACGTCGATGTCGTCCACTTGGTCTAACCTAGATGCTTCCTCTCAGCTCGCCCAGGATCTCCAGTCAGAAGTCCTCCAGAACGATTGCGGTGAAGATGG
TAAGGAGGATCGCTTAGGGTGCATTATTCTCTGCCAGTGTGCTGAATACTACATCCCTAGCCCACGAAATCATTCGGTTGACTTTCCGTAAGTCTACTCACAAATCGAAGTTGCACGAGC
TAACGCCAATCTACCACGTCCAGATGATGCCATCGCCATCAGTCGAAGCAAGGGCCCATCTGCGTGAGTACTTTGTGTGCCTCATCAGTACATGTTCACTGAAGCAGCTACGATGAATAG

CGGCGGAGGTGCCGACGGCTCCATGCTCCTCTTCCCCCTCGTCGAGCCTGAGTTCGTGGCCAACAACGGTATCTCCGACAGCGTCAACAATCTGATCCCCTTCCTGGCCAAGCACCCGAC
GATCAGCGCTGGTGACCTCGTTCAGTTCGCCGGCGCCGTAGCGCTGACCAACTGCCCC
GTAAGCGCCATTGCTATTCTTGATACTCCTTCGTTGTGCTAATGCACATTGGTGACGGTAGG
GAGCGCCGCAGCTCGAATTCCTGGCTGGCCGCCCGAACAAGACGATCCCAGCCATCGATGGCCTGATTCCCGAGCCTCAGGACAGCGTGACCAGTATTCTCGAGCGCTTTGACGATGCAG
GTGGCTTCACGCCCTTCGAGGTTGTTTCTTTGTTGGCTTCCCACAGCATCGCGCGTGCCGATAAGGTCGATGAAACGATTGATGCCGCGCCCTTCGATTCG
GTCGGTTCAGCATGCTCCT
CATTTGATCTCAAACTGACGTCATTTGCCGAACTTTAACAGACTCCCTTCACGTTTGACACCCAGGTCTTCCTTGAAGTTCTGCTCAAGGTAAAGTACTATTACGTGTGACATCGGAAAT
CGTACGTTAATCATCATGCACATTTCAGGGTGTCGGGTTCCCTGGAACGGATAACAACACTGGCGAGGTTGCGTCTCCGCTCCCTCTGACCAGCGGCACCGACACTGGCGAGTTGCGTCT
CCAGTCCGACTTCGCTCTCGCTCGTGACGAACGCACTGCCTGCTTCTGGCAGAGTTTCGTCA
GTACGTGTCATCCCCCCTTCTTTGTCTGCCTCACATTACTCACGCAACATCTTCCAGA
CGAGGAGGAGTTCATGGCTACGAGCTTCAAGAACGCCATGGCGAAGTTGGCTGTCCTCGGCCACAACACGAACGACCTGATTGACTGCTCTGACGTCGTCCCCGCGCCCAAGGCCGCTGT
CAAGAAGCCGGCCAC
GTAAGTAATATTGTTAAAGGCAAGCTTAAAGCTGCGTGATTGACCACAAACATAGATTCCCGGCCACCAAGAACGCCAGTGACCTTGAGCTGACCTGCACTGCCT
TGAGGTTCCCCACGCTCACCACTGATC
GTAAGTTTTCTCATTGCTGCATCAGTCTTCTTCGTGATCATTGACTCTTTCACAGCTGGTGCCACCGAGACCCTCATCCCTCACTGCTCTGAC
GGCAACATGACCTGTGTTACTGTGCAGTTCGACGGCCCCGCCACGGACTCCTCGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTTACTTCGCTCTTCGCACTCGTCGCTTTAGTAGCGTACACCGCTGCCTCACCCGCACCCGCTGCCGTCTGCTCTGACGGCACTCGCGTCTCCAACGAGGCTTGCTGCGCTTTC
ATTCCT
CTCGCCCAGGATCTCCAGTCAGAAGTCCTCCAGAACGATTGCGGTGAAGATGCCCACGAAATCATTCGGTTGACTTTCCATGATGCCATCGCCATCAGTCGAAGCAAGGGCCCA
TCTGC
CGGCGGAGGTGCCGACGGCTCCATGCTCCTCTTCCCCCTCGTCGAGCCTGAGTTCGTGGCCAACAACGGTATCTCCGACAGCGTCAACAATCTGATCCCCTTCCTGGCCAAGCAC
CCGACGATCAGCGCTGGTGACCTCGTTCAGTTCGCCGGCGCCGTAGCGCTGACCAACTGCCCC
GGAGCGCCGCAGCTCGAATTCCTGGCTGGCCGCCCGAACAAGACGATCCCAGCCATC
GATGGCCTGATTCCCGAGCCTCAGGACAGCGTGACCAGTATTCTCGAGCGCTTTGACGATGCAGGTGGCTTCACGCCCTTCGAGGTTGTTTCTTTGTTGGCTTCCCACAGCATCGCGCGT
GCCGATAAGGTCGATGAAACGATTGATGCCGCGCCCTTCGATTCG
ACTCCCTTCACGTTTGACACCCAGGTCTTCCTTGAAGTTCTGCTCAAGGGTGTCGGGTTCCCTGGAACGGATAAC
AACACTGGCGAGGTTGCGTCTCCGCTCCCTCTGACCAGCGGCACCGACACTGGCGAGTTGCGTCTCCAGTCCGACTTCGCTCTCGCTCGTGACGAACGCACTGCCTGCTTCTGGCAGAGT
TTCGTCA
ACGAGGAGGAGTTCATGGCTACGAGCTTCAAGAACGCCATGGCGAAGTTGGCTGTCCTCGGCCACAACACGAACGACCTGATTGACTGCTCTGACGTCGTCCCCGCGCCCAAG
GCCGCTGTCAAGAAGCCGGCCAC
ATTCCCGGCCACCAAGAACGCCAGTGACCTTGAGCTGACCTGCACTGCCTTGAGGTTCCCCACGCTCACCACTGATCCTGGTGCCACCGAGACCCTC
ATCCCTCACTGCTCTGACGGCAACATGACCTGTGTTACTGTGCAGTTCGACGGCCCCGCCACGGACTCCTCGTGA

Retrieve as FASTA