Entry information : CsuMnP09 (MnP9)
Entry ID 9644
Creation 2011-11-04 (Christophe Dunand)
Last sequence changes 2011-11-04 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-02 (Catherine Mathe (Scipio))
Peroxidase information: CsuMnP09 (MnP9)
Name (synonym) CsuMnP09 (MnP9)
Class Manganese peroxidase    [Orthogroup: MnP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Coriolaceae Ceriporiopsis
Organism Ceriporiopsis subvermispora    [TaxId: 42742 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsuMnP09
start..stop
S start..stop
CsuMnP08 564 0 23..384 22..383
CsuMnP07 557 0 26..384 24..382
CsuMnP12 553 0 15..384 16..385
CsuMnP03 550 0 6..384 7..385
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 551210..551335 126 N° 2 551099..551150 52 N° 3 550981..551047 67 N° 4 550746..550923 178
N° 5 550463..550684 222 N° 6 549973..550399 427 N° 7 549832..549914 83  
complement(join(549832..549914,549973..550399,550463..550684,550746..550923,5509 81..551047,551099..551150,551210..551335))


exon

Literature and cross-references CsuMnP09 (MnP9)
DNA ref. JGI genome:   scaffold_6 (551335..549832)
Protein sequence: CsuMnP09 (MnP9)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   384 (367)
PWM (Da):   %s   39746.31 (37911.2)  
PI (pH):   %s   3.78 (3.69) Peptide Signal:   %s   cut: 18 range:18-384
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTFVRLSLIVLVGVVHATLAAVATTCSDGTAVSNSVCCDFIPLAQDLQSILFANECGENAHEIVQLAFYDAIAISQSMGPVAGGGADGSVLIFPTVEPHFPENAAIDDAVNNLLPFLSMHPTISAGDLVQFAGAVALSNCGAPQLEFLAGRQNATAPAVAGLVPQPQDNVTSILARFADAGSFTPSEVVSLLAAHSIGRADNVDPTLFAAPFDTTPFDFDTQFFLEVLLEGTGFPGTNDNVGEVASPLPIGDVSSCGSDAGELRLQSDFALARDERTACFWQEFVNQQERMAEGFQSAMEKLASLGSNPADLIDCSDVVPEATPSNGKPATFPATTGPSDLQLTCTTQKFPSLSVDAGTTQALIPHCPDGNEDCSSVLFAGPA

Retrieve as FASTA  
Remarks Compleet sequence from genomic (8 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTTTCGTGCGCCTCTCCTTGATCGTCCTCGTGGGAGTCGTCCATGCTACCCTCGCCGCTGTCGCAACCACTTGCTCTGATGGGACGGCGGTCAGCAATTCCGTCTGCTGCGACTTC
ATTCCA
GTATGTATTCTGCACTTTTAAACGTCAGACGGTTGTGTAATCAGTCGCAACATCCACAGCTCGCCCAGGATCTACAAAGCATTCTGTTCGCGAATGAATGTGGTGAAAATGGTA
GATCTTCATTCATTGTCTCTCTTGCAGAGGAGTTGATCATCCTCCCAGCACATGAGATCGTCCAACTGGCATTCTACGACGCCATTGCGATATCTCAGAGCATGGGCCCGGTTGCGTGCG
TGCCGTATCTTGGAGCAATCTTATGTTTGACTCATTCGTGAACATTTCGCAGTGGCGGAGGAGCCGACGGTTCCGTACTCATCTTCCCGACCGTCGAGCCACATTTCCCGGAGAACGCCG
CTATCGATGACGCCGTGAACAACCTGCTGCCCTTTCTGTCCATGCACCCGACTATCTCCGCTGGCGACTTAGTCCAGTTTGCGGGTGCCGTCGCGCTCAGCAATTGTCCC
GTATGTTACA
GAGTTAACATTCTCCCTAGCCATACTAAGTTACTAACACGAGAGATTCTAGGGCGCTCCCCAACTCGAATTTCTCGCAGGCCGTCAGAATGCTACCGCCCCTGCCGTCGCCGGCTTAGTC
CCCCAGCCTCAGGACAATGTGACCTCGATTCTCGCCCGCTTCGCGGACGCGGGTAGCTTCACGCCATCTGAGGTCGTCTCCCTTCTTGCAGCGCACAGTATTGGGCGCGCGGACAATGTT
GACCCGACCCTCTTTGCCGCTCCCTTCGACACG
GTGAGTGTTCAATCACTACTTGGGAGAACGTTATTCACTCCTATGTACGGTGCGACATTGTAGACCCCCTTCGATTTCGATACGCAG
TTCTTCCTCGAGGTATTGCTCGAGGGTACCGGCTTCCCCGGAACTAACGACAACGTCGGCGAAGTCGCATCGCCTCTGCCCATCGGCGACGTCTCTTCCTGCGGCAGTGACGCCGGCGAG
CTGCGCCTTCAGTCCGACTTTGCCCTTGCGCGTGACGAGCGTACTGCGTGCTTTTGGCAGGAATTCGTCAACCAGCAGGAACGCATGGCAGAAGGCTTTCAGTCCGCAATGGAGAAGCTC
GCATCCCTCGGTTCAAATCCCGCTGACCTCATCGACTGCTCCGATGTTGTACCCGAGGCGACGCCTAGCAATGGCAAGCCCGCGACATTCCCAGCCACCACTGGCCCCAGTGATCTCCAG
TTGACTTGTACGACCCAGAAGTTCCCCTCGCTCTCCGTTGATG
GTAAGTCTGTGTGGTCTGGACATCGCTGCGCACATCTGACATGGCCCTGTCGAAAAAGCTGGTACAACGCAGGCCCT
CATCCCGCACTGCCCTGACGGCAACGAGGATTGCTCCTCTGTGCTGTTTGCTGGCCCAGCGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTTTCGTGCGCCTCTCCTTGATCGTCCTCGTGGGAGTCGTCCATGCTACCCTCGCCGCTGTCGCAACCACTTGCTCTGATGGGACGGCGGTCAGCAATTCCGTCTGCTGCGACTTC
ATTCCA
CTCGCCCAGGATCTACAAAGCATTCTGTTCGCGAATGAATGTGGTGAAAATGCACATGAGATCGTCCAACTGGCATTCTACGACGCCATTGCGATATCTCAGAGCATGGGCCCG
GTTGC
TGGCGGAGGAGCCGACGGTTCCGTACTCATCTTCCCGACCGTCGAGCCACATTTCCCGGAGAACGCCGCTATCGATGACGCCGTGAACAACCTGCTGCCCTTTCTGTCCATGCAC
CCGACTATCTCCGCTGGCGACTTAGTCCAGTTTGCGGGTGCCGTCGCGCTCAGCAATTGTCCC
GGCGCTCCCCAACTCGAATTTCTCGCAGGCCGTCAGAATGCTACCGCCCCTGCCGTC
GCCGGCTTAGTCCCCCAGCCTCAGGACAATGTGACCTCGATTCTCGCCCGCTTCGCGGACGCGGGTAGCTTCACGCCATCTGAGGTCGTCTCCCTTCTTGCAGCGCACAGTATTGGGCGC
GCGGACAATGTTGACCCGACCCTCTTTGCCGCTCCCTTCGACACG
ACCCCCTTCGATTTCGATACGCAGTTCTTCCTCGAGGTATTGCTCGAGGGTACCGGCTTCCCCGGAACTAACGAC
AACGTCGGCGAAGTCGCATCGCCTCTGCCCATCGGCGACGTCTCTTCCTGCGGCAGTGACGCCGGCGAGCTGCGCCTTCAGTCCGACTTTGCCCTTGCGCGTGACGAGCGTACTGCGTGC
TTTTGGCAGGAATTCGTCAACCAGCAGGAACGCATGGCAGAAGGCTTTCAGTCCGCAATGGAGAAGCTCGCATCCCTCGGTTCAAATCCCGCTGACCTCATCGACTGCTCCGATGTTGTA
CCCGAGGCGACGCCTAGCAATGGCAAGCCCGCGACATTCCCAGCCACCACTGGCCCCAGTGATCTCCAGTTGACTTGTACGACCCAGAAGTTCCCCTCGCTCTCCGTTGATG
CTGGTACA
ACGCAGGCCCTCATCCCGCACTGCCCTGACGGCAACGAGGATTGCTCCTCTGTGCTGTTTGCTGGCCCAGCGTAG

Retrieve as FASTA