Entry information : CsuMnP08 (MnP8)
Entry ID 9645
Creation 2011-11-04 (Christophe Dunand)
Last sequence changes 2011-11-04 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-02 (Catherine Mathe (Scipio))
Peroxidase information: CsuMnP08 (MnP8)
Name (synonym) CsuMnP08 (MnP8)
Class Manganese peroxidase    [Orthogroup: MnP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Coriolaceae Ceriporiopsis
Organism Ceriporiopsis subvermispora    [TaxId: 42742 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsuMnP08
start..stop
S start..stop
CsuMnP03 634 0 1..383 1..385
CsuMnP07 608 0 25..383 24..382
CsuMnP01 607 0 17..383 17..385
PstrMnP06 592 0 1..383 1..378
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 401273..401395 123 N° 2 401454..401505 52 N° 3 401561..401627 67 N° 4 401685..401862 178
N° 5 401919..402140 222 N° 6 402200..402626 427 N° 7 402683..402765 83  
join(401273..401395,401454..401505,401561..401627,401685..401862,401919..402140, 402200..402626,402683..402765)


exon

Literature and cross-references CsuMnP08 (MnP8)
DNA ref. JGI genome:   scaffold_6 (401273..402765)
Protein sequence: CsuMnP08 (MnP8)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   383 (365)
PWM (Da):   %s   39610.04 (37836.0)  
PI (pH):   %s   3.74 (3.70) Peptide Signal:   %s   cut: 19 range:19-383
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFASLLAFVAVAAIARAAPASVTCSDGTTVPDSVCCDFIPLAEDLQSTLFMNQCGEDAHEVIRLTFHDAISISQSLGPSAGGGADGSMLIFPTVEPNFPANNGIDDSVNNLIPFLSTHPTISAGDLVQFAGAVALTNCGAPRLQFMAGRPNATAPAVIGLIPQPQDNVTSILDRFADAGNFSPFEVVSLLASHSVARADKVDLTLDAAPFDSTPFDFDTQIFLEVLLKGTGFPGTDDNVGEVESPLPFGDTSTGGNDTGEMRLQSDFALARDSRTACFWQGFVDQQDFMSQSFGAAMAKLAVLGQNTANLVDCSAVVPAATPSSGNPATFPATTSPDDLELTCTTETFPSLSVDPGAVETLIPHCPDGSEDCPTVQFSGPA

Retrieve as FASTA  
Remarks Complete seqeunce from genomic (7 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCGCGTCCCTCCTCGCTTTCGTCGCCGTCGCAGCAATCGCTCGCGCTGCCCCCGCCTCCGTCACTTGCTCTGATGGTACGACGGTCCCTGACTCCGTCTGTTGCGACTTTATC
CCT
GTGCGTACCCTGCGGTTTGAGCTGCTAGTGATTTAGAGTGACTCATAAGTATATGCAGCTCGCGGAGGACCTCCAGAGCACTCTGTTCATGAATCAGTGCGGCGAAGATGGTGAGTC
ATTGCTCAGCGTGCCGCCGTCCTGAACCGGAGCTCATTGTCTTGGTAGCACACGAGGTCATTCGGCTGACTTTCCACGACGCCATTTCGATTTCTCAGAGCTTGGGTCCCTCTGCGTACG
TATTTCTGATAGGCATATATCGGCATCCACTCAGCTGATGTGTGCCTTATAGTGGTGGCGGAGCTGACGGTTCCATGCTGATCTTCCCGACCGTCGAGCCGAACTTCCCGGCAAACAACG
GTATTGATGACTCCGTGAACAACTTGATCCCCTTCCTATCCACGCACCCGACAATCTCCGCTGGTGACCTTGTACAATTCGCTGGCGCTGTCGCGCTTACCAACTGCCCC
GTAAGCAACA
GAAAAATGAGTTTTCTGATATTATACTCATGCGCGAGATAATCTAGGGTGCTCCCCGGCTCCAGTTCATGGCGGGTCGTCCGAACGCTACCGCTCCCGCCGTCATTGGTCTGATCCCCCA
GCCTCAAGACAACGTGACTTCGATTCTCGACCGCTTCGCAGACGCCGGTAACTTCTCGCCGTTCGAGGTTGTCTCCCTCCTTGCATCCCACAGTGTCGCGCGTGCGGACAAAGTTGACCT
GACTCTCGATGCTGCTCCCTTCGACTCG
GTGAGTATTTCTTTGCTGACCACGAGAGCGCGGTCCATTCTGACGCCAAGGCACCACAGACGCCATTCGACTTCGACACCCAGATATTCCTT
GAAGTGCTGCTCAAGGGTACTGGCTTCCCCGGAACTGACGACAACGTCGGTGAGGTTGAGTCTCCCCTCCCCTTCGGTGACACCTCCACCGGCGGAAACGACACCGGCGAGATGCGCCTC
CAGTCCGACTTCGCTCTCGCGCGCGACTCGCGCACCGCATGCTTCTGGCAGGGCTTCGTTGACCAGCAGGACTTCATGTCCCAGAGCTTCGGCGCTGCCATGGCCAAGCTCGCAGTCCTC
GGTCAAAACACTGCCAACCTCGTCGACTGTTCCGCTGTTGTGCCCGCGGCGACGCCCAGCAGCGGCAACCCCGCGACGTTCCCGGCCACCACCAGCCCCGATGACCTCGAGCTGACCTGC
ACGACCGAGACGTTCCCCTCGCTCTCCGTTGACC
GTGAGTACCCCGCATTCAGTGAACAGTAATGTCTGGCTGACAGCTATTCATTCTAGCCGGTGCGGTTGAGACCCTCATCCCGCACT
GCCCTGACGGCAGCGAGGACTGCCCGACCGTCCAGTTCTCTGGCCCCGCATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCGCGTCCCTCCTCGCTTTCGTCGCCGTCGCAGCAATCGCTCGCGCTGCCCCCGCCTCCGTCACTTGCTCTGATGGTACGACGGTCCCTGACTCCGTCTGTTGCGACTTTATC
CCT
CTCGCGGAGGACCTCCAGAGCACTCTGTTCATGAATCAGTGCGGCGAAGATGCACACGAGGTCATTCGGCTGACTTTCCACGACGCCATTTCGATTTCTCAGAGCTTGGGTCCCTCT
GC
TGGTGGCGGAGCTGACGGTTCCATGCTGATCTTCCCGACCGTCGAGCCGAACTTCCCGGCAAACAACGGTATTGATGACTCCGTGAACAACTTGATCCCCTTCCTATCCACGCACCCG
ACAATCTCCGCTGGTGACCTTGTACAATTCGCTGGCGCTGTCGCGCTTACCAACTGCCCC
GGTGCTCCCCGGCTCCAGTTCATGGCGGGTCGTCCGAACGCTACCGCTCCCGCCGTCATT
GGTCTGATCCCCCAGCCTCAAGACAACGTGACTTCGATTCTCGACCGCTTCGCAGACGCCGGTAACTTCTCGCCGTTCGAGGTTGTCTCCCTCCTTGCATCCCACAGTGTCGCGCGTGCG
GACAAAGTTGACCTGACTCTCGATGCTGCTCCCTTCGACTCG
ACGCCATTCGACTTCGACACCCAGATATTCCTTGAAGTGCTGCTCAAGGGTACTGGCTTCCCCGGAACTGACGACAAC
GTCGGTGAGGTTGAGTCTCCCCTCCCCTTCGGTGACACCTCCACCGGCGGAAACGACACCGGCGAGATGCGCCTCCAGTCCGACTTCGCTCTCGCGCGCGACTCGCGCACCGCATGCTTC
TGGCAGGGCTTCGTTGACCAGCAGGACTTCATGTCCCAGAGCTTCGGCGCTGCCATGGCCAAGCTCGCAGTCCTCGGTCAAAACACTGCCAACCTCGTCGACTGTTCCGCTGTTGTGCCC
GCGGCGACGCCCAGCAGCGGCAACCCCGCGACGTTCCCGGCCACCACCAGCCCCGATGACCTCGAGCTGACCTGCACGACCGAGACGTTCCCCTCGCTCTCCGTTGACC
CCGGTGCGGTT
GAGACCCTCATCCCGCACTGCCCTGACGGCAGCGAGGACTGCCCGACCGTCCAGTTCTCTGGCCCCGCATAA

Retrieve as FASTA