Entry information : CsuMnP[P]
Entry ID 9646
Creation 2011-11-04 (Christophe Dunand)
Last sequence changes 2012-04-03 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2012-04-03 (Christophe Dunand)
Peroxidase information: CsuMnP[P]
Name CsuMnP[P]
Class Manganese peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Coriolaceae Ceriporiopsis
Organism Ceriporiopsis subvermispora    [TaxId: 42742 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsuMnP[P]
start..stop
S start..stop
CsuMnP05 172 7e-53 1..172 198..371
CsuMnP04 166 8e-51 1..175 198..374
CsuMnP10 162 4e-49 1..172 199..372
CsuMnP11 155 2e-46 1..175 199..379
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 418625..418669 45 N° 2 418181..418567 387 N° 3 417987..418130 144  
complement(join(417987..418130,418181..418567,418625..418669))


exon

Literature and cross-references CsuMnP[P]
DNA ref. JGI genome:   scaffold_6 (418669..417987)
Protein sequence: CsuMnP[P]
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   191
PWM (Da):   %s   20527.2  
PI (pH):   %s   7.57
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
SDKAEGTIDAALFDSTQPSSDAHVFLEVLLKGVGFPESTTTLARSRLLPRSIMATTLESASSARLRPCPHACFWQSFVDEQEFMTHNFKATMFKLAFPSHDRASLMDCSDGVPAPKHAVNKPATVRASTGPKGLELSCFAERLPLTRSPPIAGATQILISHCSHDGQDCATVPRTSGQLGYHLLRGSHTYL*

Retrieve as FASTA  
Remarks Pseudogene from genomic . Incorrect prediction from JGI (Large 5' end is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TCAGACAAGGCCGAGGGGACCATTGACGCGGCACTTTTCGATTCGGTCGGTGCCCATGACGGCCTTCAAATTCGCATATTTTCCAACAACGCCGCAACCCAGACCCAACCCAGCTCCGAC
GCCCATGTCTTCCTTGAGGTGCTGCTCAAGGGCGTCGGCTTCCCCGAATCGACAACAACACTAGCAAGGTCGCGTCTCCTCCCCCGCTCAATAATGGCGACGACGCTGGAGAGTGCGTCC
TCGGCCCGACTTCGCCCTTGCCCGCACGCTTGCTTCTGGCAAAGCTTCGTCGATGAGCAGGAGTTCATGACGCATAACTTCAAGGCCACGATGTTCAAGCTCGCTTTTCCTAGCCACGAC
CGCGCGAGCCTGATGGACTGTTCTGACGGTGTCCCGGCTCCGAAGCACGCCGTCAACAAGCCCGCAACCGTCCGCGCGAGCACTGGCCCCAAGGGCCTCGAGCTGAGCTGCTTCGCGGAG
CGCTTGCCA
GCACTCCCCGTTGCTCGTGAGTACATTTGAAGAGCTTCCGCGTTCAATGGCTCACACGAAGTCCTCCAATAGCTGGTGCAACGCAGATCCTCATCTCTCACTGCTCTCACG
ATGGACAGGACTGTGCGACCGTCCCACGCACAAGCGGTCAGCTAGGATATCACCTACTACGAGGGTCTCATACGTATCTGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TCAGACAAGGCCGAGGGGACCATTGACGCGGCACTTTTCGATTCGACCCAACCCAGCTCCGACGCCCATGTCTTCCTTGAGGTGCTGCTCAAGGGCGTCGGCTTCCCCGAATCGACAACA
ACACTAGCAAGGTCGCGTCTCCTCCCCCGCTCAATAATGGCGACGACGCTGGAGAGTGCGTCCTCGGCCCGACTTCGCCCTTGCCCGCACGCTTGCTTCTGGCAAAGCTTCGTCGATGAG
CAGGAGTTCATGACGCATAACTTCAAGGCCACGATGTTCAAGCTCGCTTTTCCTAGCCACGACCGCGCGAGCCTGATGGACTGTTCTGACGGTGTCCCGGCTCCGAAGCACGCCGTCAAC
AAGCCCGCAACCGTCCGCGCGAGCACTGGCCCCAAGGGCCTCGAGCTGAGCTGCTTCGCGGAGCGCTTGCCA
CTCACACGAAGTCCTCCAATAGCTGGTGCAACGCAGATCCTCATCTCT
CACTGCTCTCACGATGGACAGGACTGTGCGACCGTCCCACGCACAAGCGGTCAGCTAGGATATCACCTACTACGAGGGTCTCATACGTATCTGTAG

Retrieve as FASTA