Entry information : CsuMnP10 (MnP10)
Entry ID 9648
Creation 2011-11-04 (Christophe Dunand)
Last sequence changes 2011-11-04 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-02 (Catherine Mathe (Scipio))
Peroxidase information: CsuMnP10 (MnP10)
Name (synonym) CsuMnP10 (MnP10)
Class Manganese peroxidase    [Orthogroup: MnP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Coriolaceae Ceriporiopsis
Organism Ceriporiopsis subvermispora    [TaxId: 42742 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsuMnP10
start..stop
S start..stop
CsuMnP05 673 0 1..378 1..377
PgigMnP02 649 0 1..378 1..384
PbreMnP01 647 0 1..378 1..380
CsuMnP04 645 0 1..378 1..377
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 185107..185226 120 N° 2 184993..185044 52 N° 3 184915..184941 27 N° 4 184821..184860 40
N° 5 184587..184764 178 N° 6 184305..184526 222 N° 7 183836..184250 415 N° 8 183695..183777 83
complement(join(183695..183777,183836..184250,184305..184526,184587..184764,1848 21..184860,184915..184941,184993..185044,185107..185226))


exon

Literature and cross-references CsuMnP10 (MnP10)
DNA ref. JGI genome:   scaffold_14 (185226..183695)
Protein sequence: CsuMnP10 (MnP10)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   378 (360)
PWM (Da):   %s   39821.73 (38100.8)  
PI (pH):   %s   4.49 (4.49) Peptide Signal:   %s   cut: 19 range:19-378
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFTSFVALAALVGIASAAPTTICPDGTRVSNHACCAFIPLAEDLQKTIFMNDCGEDAHEVIRLTFHDAVAISRKLGPKAGGGADGSMLLFPTVEPNFSANNGIDDSVNNLIPFMARHPTVSAGDLVQFAGAVALSNCGAPRLEFLAGRPNHTIAAIDGLIPEPQDDVTKILERFDDAGGFTPFEVVSLLASHTVARADKVDETIDAAPFDSTPFTFDTQVFLEVLLKGVGFPGTDNNTGEVASPLPKGSGNDTGEMRLQSDFALARDPRTACFWQGFVDEQEFMAESFKAAMAKLAILGHNRASLTDCSDVVPIPRPAVKKPASFPATTGPKDLELTCRAERFPTLTVDRGAVQALIPHCSNGGQDCPSVQFDGPA

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCACTTCCTTCGTTGCCCTCGCTGCCCTTGTCGGCATTGCTAGTGCAGCGCCGACTACCATTTGCCCGGACGGTACTCGCGTGAGCAACCATGCCTGCTGCGCTTTTATCCCG
GTATGTGCGATACCACCGGATGCCCGTTGAGAATGATAGGGTTCTAAACTTTACGTGAATAGCTTGCTGAGGATCTGCAGAAGACCATCTTCATGAACGATTGTGGGGAAGATGGTAAGT
GCATTCCTAGTATCTTGTATCTAACTCAACTAAGAATATCATCAGCGCACGAGGTCATCCGTCTCACTTTCCGTCAGTAGTCAATTTGCACTCAATGGTGTTTCGGTGATTGATTTGCCA
CTGCAGATGATGCCGTCGCAATTTCTCGCAAGCTCGGCCCCAAAGCGTACGTTATGAACGTCTTCGGTGTTTCGATTAGACATTGATTCTGAGAACCATCAGTGGTGGCGGAGCTGACGG
TTCGATGCTGCTCTTCCCTACCGTGGAGCCAAATTTCTCTGCCAACAACGGTATCGACGACAGCGTGAATAACTTGATTCCCTTCATGGCCAGGCATCCTACTGTCAGTGCTGGTGATCT
GGTCCAGTTTGCTGGTGCTGTGGCACTGAGCAACTGCCCA
GTGAGTTAATCGTCTCGTACTTTCATTATCCTGAGATTAAGCACAGTTTGACATTCACAGGGTGCTCCTCGTCTTGAATT
TCTTGCAGGCCGCCCTAATCACACCATCGCTGCCATTGACGGTCTGATTCCGGAGCCACAAGATGACGTGACAAAGATTCTCGAGCGTTTCGACGACGCGGGCGGATTCACGCCATTCGA
GGTTGTGTCTCTTCTTGCCTCACATACTGTCGCTCGTGCGGACAAGGTCGACGAGACCATTGATGCTGCACCATTCGATTCA
GTAAGTTACGCTTGCATCTTGATCCGAGTCATGCCCTG
ACCATTTCTGTACCAGACTCCCTTCACGTTCGACACTCAGGTCTTCCTCGAAGTATTGCTGAAGGGCGTCGGATTTCCAGGAACGGACAACAACACCGGCGAGGTCGCGTCCCCGCTTCC
GAAGGGCAGTGGCAACGACACCGGCGAGATGCGTCTGCAGTCCGATTTTGCGCTCGCCCGCGACCCGCGCACGGCTTGCTTCTGGCAAGGTTTCGTCGATGAGCAGGAATTTATGGCAGA
GAGCTTCAAGGCCGCAATGGCTAAACTTGCGATCCTCGGCCACAATCGCGCAAGCCTGACCGACTGCTCCGACGTCGTGCCCATTCCAAGGCCCGCTGTTAAAAAGCCTGCGTCATTCCC
TGCCACTACCGGTCCAAAGGACCTCGAGCTGACTTGTAGGGCTGAGAGGTTCCCTACCCTTACAGTCGACC
GTACGTCATTCTCAACTTGAAATAAAACGTTTCTCCTGACTTTATTTTG
GTGGTATAGGTGGTGCTGTCCAAGCTCTCATTCCCCATTGCTCAAACGGCGGGCAAGACTGCCCTTCTGTCCAGTTCGATGGACCAGCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCACTTCCTTCGTTGCCCTCGCTGCCCTTGTCGGCATTGCTAGTGCAGCGCCGACTACCATTTGCCCGGACGGTACTCGCGTGAGCAACCATGCCTGCTGCGCTTTTATCCCG
CTTGCTGAGGATCTGCAGAAGACCATCTTCATGAACGATTGTGGGGAAGATGCGCACGAGGTCATCCGTCTCACTTTCCATGATGCCGTCGCAATTTCTCGCAAGCTCGGCCCCAAAGCT
GGTGGCGGAGCTGACGGTTCGATGCTGCTCTTCCCTACCGTGGAGCCAAATTTCTCTGCCAACAACGGTATCGACGACAGCGTGAATAACTTGATTCCCTTCATGGCCAGGCATCCTACT
GTCAGTGCTGGTGATCTGGTCCAGTTTGCTGGTGCTGTGGCACTGAGCAACTGCCCA
GGTGCTCCTCGTCTTGAATTTCTTGCAGGCCGCCCTAATCACACCATCGCTGCCATTGACGGT
CTGATTCCGGAGCCACAAGATGACGTGACAAAGATTCTCGAGCGTTTCGACGACGCGGGCGGATTCACGCCATTCGAGGTTGTGTCTCTTCTTGCCTCACATACTGTCGCTCGTGCGGAC
AAGGTCGACGAGACCATTGATGCTGCACCATTCGATTCA
ACTCCCTTCACGTTCGACACTCAGGTCTTCCTCGAAGTATTGCTGAAGGGCGTCGGATTTCCAGGAACGGACAACAACACC
GGCGAGGTCGCGTCCCCGCTTCCGAAGGGCAGTGGCAACGACACCGGCGAGATGCGTCTGCAGTCCGATTTTGCGCTCGCCCGCGACCCGCGCACGGCTTGCTTCTGGCAAGGTTTCGTC
GATGAGCAGGAATTTATGGCAGAGAGCTTCAAGGCCGCAATGGCTAAACTTGCGATCCTCGGCCACAATCGCGCAAGCCTGACCGACTGCTCCGACGTCGTGCCCATTCCAAGGCCCGCT
GTTAAAAAGCCTGCGTCATTCCCTGCCACTACCGGTCCAAAGGACCTCGAGCTGACTTGTAGGGCTGAGAGGTTCCCTACCCTTACAGTCGACC
GTGGTGCTGTCCAAGCTCTCATTCCC
CATTGCTCAAACGGCGGGCAAGACTGCCCTTCTGTCCAGTTCGATGGACCAGCTTGA

Retrieve as FASTA