Entry information : CsuLiP01(LiP1)
Entry ID 9652
Creation 2011-11-04 (Christophe Dunand)
Last sequence changes 2011-11-04 (Christophe Dunand)
Sequence status complete
Reviewer Catherine
Last annotation changes 2019-05-10 (Catherine )
Peroxidase information: CsuLiP01(LiP1)
Name CsuLiP01(LiP1)
Class Lignin peroxidase    [Orthogroup: LiP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Coriolaceae Ceriporiopsis
Organism Ceriporiopsis subvermispora    [TaxId: 42742 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsuLiP01
start..stop
S start..stop
GsppCIIBB07 521 0 1..364 1..365
PoVP04_PC15 502 5e-180 1..364 1..357
CsuLiP02 497 4e-178 1..364 1..364
TvCIIBB02 496 9e-178 1..364 1..365
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 498010..498070 61 N° 2 497741..497945 205 N° 3 497623..497690 68 N° 4 497502..497568 67
N° 5 497375..497442 68 N° 6 497311..497322 12 N° 7 497214..497255 42 N° 8 497078..497156 79
N° 9 496899..497024 126 N° 10 496779..496848 70 N° 11 496681..496726 46 N° 12 496525..496622 98
N° 13 496398..496472 75 N° 14 496279..496343 65 N° 15 496211..496223 13  
complement(join(496211..496223,496279..496343,496398..496472,496525..496622,4966 81..496726,496779..496848,496899..497024,497078..497156,497214..497255,497311..4 97322,497375..497442,497502..497568,497623..497690,497741..497945,498010..498070 ))


exon

Literature and cross-references CsuLiP01(LiP1)
DNA ref. JGI genome:   scaffold_20 (498070..496211)
Cluster/Prediction ref. JGI gene:   99382
Protein sequence: CsuLiP01(LiP1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   364 (343)
PWM (Da):   %s   38132.71 (35832.4)  
PI (pH):   %s   3.89 (3.85) Peptide Signal:   %s   cut: 22 range:22-364
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVFQVLASFITVLAVLQVNRAAVTKRVTCPDGSMTANEACCVLFPVLEDIQQNLFDGGLCGEEAHESLRLTFHDAFGFSPALQAQGQFGGGGADGSVIVFEETEANFAANGIDEIINAQKPFIARHNITPGDFVQFAGAVGAANCPGAPQLQFMGRPMPVASSPDGLIPEPFDTVDSIIERFADAGNFTETEIIWLLTAHSIAAADEVDPTIPGTPFDSTPGIFDSQIFIEVQLRGTSFPGTGGNQGEVESPLRGELRLQSDSLARDSRTACEWQAFVDNVPRMQTLFSAAMSTLAVIGQDTSQMVDCSDIPVPPPPQGTAHIPAGLSNADIEQACATAAFPSLPVDPGPATSVAPVPPA

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTTTCCAGGTCCTTGCGTCCTTCATCACCGTACTTGCCGTTCTCCAAGTCAACAGAGGTCCGTCTACGTTATCCTTTACCATCTATCATCCACGGAAATCCACTCACGTCCCTGAT
CACAGCTGCCGTCACCAAGCGCGTAACATGCCCCGACGGCAGCATGACCGCGAATGAGGCTTGTTGTGTGCTTTTCCCTGTCCTAGAGGACATTCAGCAGAACCTCTTCGACGGCGGTCT
GTGCGGCGAGGAAGCACATGAGTCCCTCCGACTCACGTTCCACGACGCTTTTGGCTTCTCGCCAGCCCTCCAGGCTCAGGGACAATTTGG
GTACGTGCACTCATTCCGCTAGTGATTATA
CATCTCTGATCGAGTATCAGTGGCGGAGGTGCAGATGGCTCCGTCATCGTCTTCGAAGAAACAGAGGCAAACTTCGCCGCCAATATCGGTGTGTTCACATAGGTCCTCAGCTGGAAAATC
CTGGTTAATCCTCGTCCTGTAGGCATCGACGAGATCATAAACGCCCAGAAGCCCTTCATTGCCAGACACAACATCACCCCTGGTGACTTGTAAGTCTGTACATGCATGTTCTTGGACTAG
TGCTCACGCATACGCTATCGTGTCATAGCGTCCAATTTGCCGGGGCTGTCGGCGCCGCCAATTGTCCGGGAGCTCCCCAACTGCAATTCATGCTTGGTAAGCTCTGCTGCGAGTCTTTGG
ATTAGACGTTGATTCAATGCTCTTGTAGGCCGCCCGATGCGTAAGTCTCGGCATGCTATACGAATCAAATACTATCTGACTGGATTTCACCCCAGCTGTCGCTTCATCCCCCGATGGTCT
TATTCCCGAGCCCTTCG
GTACGGTGTAATGTATGAACTAGATGACTGCCGTTGCTGAGCATTCCAAACTTTTAGACACTGTCGATTCGATCATTGAGCGCTTCGCTGATGCTGGCAATTT
CACTGAAACAGAAATTATTTGGCTGCTCACAGC
GTGAGTAGAGTTTTATTCCAGTGAACCGAAAGGTATAACCCAAGTTGCATTAGCCACTCGATCGCGGCTGCCGACGAGGTCGATCCT
ACCATCCCGGGGACACCGTTCGACTCTACACCAGGCATTTTCGACAGTCAAATCTTCATCGAGGTTCAGCTGAGAGGCACCAGCTTCCCAGG
GTCAGTTGTCAACATTGTGTACACTAAA
TGTATCTGACATCCGTCCGCAGAACTGGCGGGAACCAGGGCGAGGTTGAATCTCCGCTCAGGGGAGAACTGCGCCTGCAATCCGACTCTGAGGTTTGTGTCGTATACCTGTCATCATCTG
CAACTGGCTGACGGGGCCTCACAGCTCGCTCGTGACTCGCGTACTGCCTGCGAGTGGCAGGCGTTTGTCGGTGGGCATCATTAACACGCATCTCACATATTAGAAGGCTCATGGTTTCTC
CAAAACAGATAACGTGCCGAGGATGCAGACTTTGTTTAGTGCTGCTATGTCGACGCTCGCCGTGATTGGACAGGACACCTCCCAGATGGTCGACTGTTCCGATGTGGTCCGTGCTGCTTG
CTTCGAATACTATGCATGTGCATGATGCTTGTCCGCAGATCCCGGTCCCACCCCCGCCTCAGGGAACCGCTCACATCCCTGCTGGCCTGAGCAACGCTGACATAGAGCAGGCTGTGCGTC
ATTTCTCTTTCGTTTCGTGAAAGCCATGTGCTCATTGCACTACCCAGTGCGCTACTGCTGCGTTCCCGAGTCTCCCGGTTGACCCCGGTCCGGCTACTTCTGTTGCCCCCGTGTAAGTGT
GACCACAATGTGGAGTGCGCATAATGCTAATCGGATTCGTGTCGCAGTCCGCCAGCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTTTCCAGGTCCTTGCGTCCTTCATCACCGTACTTGCCGTTCTCCAAGTCAACAGAGCTGCCGTCACCAAGCGCGTAACATGCCCCGACGGCAGCATGACCGCGAATGAGGCTTGT
TGTGTGCTTTTCCCTGTCCTAGAGGACATTCAGCAGAACCTCTTCGACGGCGGTCTGTGCGGCGAGGAAGCACATGAGTCCCTCCGACTCACGTTCCACGACGCTTTTGGCTTCTCGCCA
GCCCTCCAGGCTCAGGGACAATTTGG
TGGCGGAGGTGCAGATGGCTCCGTCATCGTCTTCGAAGAAACAGAGGCAAACTTCGCCGCCAATATCGGCATCGACGAGATCATAAACGCCCAG
AAGCCCTTCATTGCCAGACACAACATCACCCCTGGTGACTT
CGTCCAATTTGCCGGGGCTGTCGGCGCCGCCAATTGTCCGGGAGCTCCCCAACTGCAATTCATGCTTGGCCGCCCGATG
C
CTGTCGCTTCATCCCCCGATGGTCTTATTCCCGAGCCCTTCGACACTGTCGATTCGATCATTGAGCGCTTCGCTGATGCTGGCAATTTCACTGAAACAGAAATTATTTGGCTGCTCACA
GC
CCACTCGATCGCGGCTGCCGACGAGGTCGATCCTACCATCCCGGGGACACCGTTCGACTCTACACCAGGCATTTTCGACAGTCAAATCTTCATCGAGGTTCAGCTGAGAGGCACCAGC
TTCCCAGG
AACTGGCGGGAACCAGGGCGAGGTTGAATCTCCGCTCAGGGGAGAACTGCGCCTGCAATCCGACTCTGAGCTCGCTCGTGACTCGCGTACTGCCTGCGAGTGGCAGGCGTTT
GTCG
ATAACGTGCCGAGGATGCAGACTTTGTTTAGTGCTGCTATGTCGACGCTCGCCGTGATTGGACAGGACACCTCCCAGATGGTCGACTGTTCCGATGTGATCCCGGTCCCACCCCCG
CCTCAGGGAACCGCTCACATCCCTGCTGGCCTGAGCAACGCTGACATAGAGCAGGCT
TGCGCTACTGCTGCGTTCCCGAGTCTCCCGGTTGACCCCGGTCCGGCTACTTCTGTTGCCCCC
GT
TCCGCCAGCTTGA

Retrieve as FASTA