Entry information : CsuMnP05 (MnP05)
Entry ID 9655
Creation 2011-11-04 (Christophe Dunand)
Last sequence changes 2011-11-04 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-02 (Catherine Mathe (Scipio))
Peroxidase information: CsuMnP05 (MnP05)
Name (synonym) CsuMnP05 (MnP05)
Class Manganese peroxidase    [Orthogroup: MnP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Coriolaceae Ceriporiopsis
Organism Ceriporiopsis subvermispora    [TaxId: 42742 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsuMnP05
start..stop
S start..stop
CsuMnP04 687 0 1..377 1..377
CsuMnP10 673 0 1..377 1..378
PsoMnP02 646 0 1..377 1..377
PbreMnP04 646 0 1..377 1..380
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 425545..425664 120 N° 2 425438..425489 52 N° 3 425315..425381 67 N° 4 425083..425257 175
N° 5 424797..425018 222 N° 6 424324..424738 415 N° 7 424184..424266 83  
complement(join(424184..424266,424324..424738,424797..425018,425083..425257,4253 15..425381,425438..425489,425545..425664))


exon

Literature and cross-references CsuMnP05 (MnP05)
DNA ref. JGI genome:   scaffold_6 (425664..424184)
Protein sequence: CsuMnP05 (MnP05)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   377 (359)
PWM (Da):   %s   39439.38 (37637.4)  
PI (pH):   %s   4.23 (4.18) Peptide Signal:   %s   cut: 19 range:19-377
Sequence 418
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFTSLLALSALVAVSRAAPTAVCSDGTRVSNSACCAFIPLAQDLQETLFMNDCGEDAHEVIRLTFHDAVAISRSQGPSAGGGADGSMLLFPTVEPNFSANNGIDDSVNNLIPFLAKHPVSAGDLVQFAGAIALTNCPGAPQLEFLAGRPNHTIAAVDGLIPEPQDDVTKILARFDDAGGFSPFEVVSLLASHTVARADKVDETIDAAPFDSTPFTFDTQVFLEVLLKGVGFPGTDNNTGEVASPLPLTSGNDTGEMRLQSDFALARDSRTACFWQGFVNEQEFMAQSFKAAMSKLAVLGHSRSDLIDCSDVIPTPKPAVNKPATFPASTGPKDLELSCFAERFPTLPVTPGATQTLIPHCSNGGEDCPTVQFTGPA

Retrieve as FASTA  
Remarks complete sequence from genomic (6 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCACTTCTCTGCTCGCCCTCTCTGCATTGGTCGCGGTATCGCGCGCTGCGCCGACCGCCGTCTGCTCTGATGGCACTCGCGTCAGCAACTCCGCCTGCTGTGCGTTCATCCCG
GTACGTGCAATAATGATTCCCAGATACAAGTACATGATACCGAACAATACACTAGCTTGCGCAGGACCTGCAAGAGACGCTATTCATGAATGATTGTGGTGAAGACGGTGAATATCGCCT
CATAATACGCATACTCTCAGACATGCTCATGGGTACTCTGCAGCTCACGAGGTCATCCGTCTGACTTTCCACGACGCTGTTGCGATTTCTCGCAGCCAGGGCCCGTCTGCGTACGTATTT
CGGTCTCTAGAATAGAACCAGCACGTGACTGAGTCGTACTTCCGCAGTGGTGGCGGAGCTGACGGCTCGATGCTTCTGTTCCCGACTGTCGAGCCAAACTTCTCGGCTAACAACGGTATC
GACGACTCCGTGAATAACCTTATTCCCTTTTTGGCAAAGCATCCCGTCAGCGCTGGCGATCTCGTCCAATTCGCAGGCGCTATCGCTCTCACAAATTGCCCT
GTAAGCAATAACGAAACT
CTCATGCGTCTCGGATAGTTCCGCTTATGCATAACGTATCCTTCAGGGCGCTCCTCAGCTCGAGTTCTTGGCCGGTCGCCCCAACCACACCATCGCCGCCGTCGATGGTCTGATCCCCGA
GCCTCAGGACGATGTCACTAAAATTCTCGCCCGTTTCGACGATGCTGGAGGCTTCAGCCCCTTCGAAGTCGTCTCGCTTTTGGCCTCTCACACCGTAGCCCGTGCAGACAAGGTCGATGA
GACCATCGATGCGGCTCCTTTTGATTCG
GTCAGTACCCATGATGGCCTTCAACTTCGCACATTGTCCTAACACTGTCCCAATCCAGACCCCGTTCACCTTTGACACTCAGGTCTTCCTTG
AGGTGCTGCTCAAGGGCGTCGGCTTCCCCGGAACCGATAACAACACTGGCGAGGTTGCATCTCCTCTCCCGCTCACCAGTGGCAACGACACTGGTGAAATGCGCCTCCAGTCCGACTTCG
CCCTTGCCCGCGACTCGCGTACCGCTTGCTTCTGGCAAGGCTTCGTCAACGAGCAGGAATTCATGGCGCAGAGCTTCAAGGCCGCGATGTCCAAGCTCGCGGTTCTCGGCCACAGCCGCT
CAGATCTGATTGACTGCTCCGATGTTATCCCGACCCCGAAGCCCGCCGTCAACAAGCCCGCAACCTTCCCCGCGAGCACTGGTCCCAAGGACCTCGAGCTCAGCTGCTTCGCGGAGCGCT
TCCCGACACTCCCTGTTACCC
GTGAGTACATCAATCTCAGGAATTCCGCGCTTAATGGCTCACACGGATCTTCACTAGCTGGTGCAACGCAGACCCTCATCCCTCACTGCTCTAACGGTG
GAGAGGACTGCCCGACCGTCCAATTCACTGGCCCCGCATA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCACTTCTCTGCTCGCCCTCTCTGCATTGGTCGCGGTATCGCGCGCTGCGCCGACCGCCGTCTGCTCTGATGGCACTCGCGTCAGCAACTCCGCCTGCTGTGCGTTCATCCCG
CTTGCGCAGGACCTGCAAGAGACGCTATTCATGAATGATTGTGGTGAAGACGCTCACGAGGTCATCCGTCTGACTTTCCACGACGCTGTTGCGATTTCTCGCAGCCAGGGCCCGTCTGCT
GGTGGCGGAGCTGACGGCTCGATGCTTCTGTTCCCGACTGTCGAGCCAAACTTCTCGGCTAACAACGGTATCGACGACTCCGTGAATAACCTTATTCCCTTTTTGGCAAAGCATCCCGTC
AGCGCTGGCGATCTCGTCCAATTCGCAGGCGCTATCGCTCTCACAAATTGCCCT
GGCGCTCCTCAGCTCGAGTTCTTGGCCGGTCGCCCCAACCACACCATCGCCGCCGTCGATGGTCTG
ATCCCCGAGCCTCAGGACGATGTCACTAAAATTCTCGCCCGTTTCGACGATGCTGGAGGCTTCAGCCCCTTCGAAGTCGTCTCGCTTTTGGCCTCTCACACCGTAGCCCGTGCAGACAAG
GTCGATGAGACCATCGATGCGGCTCCTTTTGATTCG
ACCCCGTTCACCTTTGACACTCAGGTCTTCCTTGAGGTGCTGCTCAAGGGCGTCGGCTTCCCCGGAACCGATAACAACACTGGC
GAGGTTGCATCTCCTCTCCCGCTCACCAGTGGCAACGACACTGGTGAAATGCGCCTCCAGTCCGACTTCGCCCTTGCCCGCGACTCGCGTACCGCTTGCTTCTGGCAAGGCTTCGTCAAC
GAGCAGGAATTCATGGCGCAGAGCTTCAAGGCCGCGATGTCCAAGCTCGCGGTTCTCGGCCACAGCCGCTCAGATCTGATTGACTGCTCCGATGTTATCCCGACCCCGAAGCCCGCCGTC
AACAAGCCCGCAACCTTCCCCGCGAGCACTGGTCCCAAGGACCTCGAGCTCAGCTGCTTCGCGGAGCGCTTCCCGACACTCCCTGTTACCC
CTGGTGCAACGCAGACCCTCATCCCTCAC
TGCTCTAACGGTGGAGAGGACTGCCCGACCGTCCAATTCACTGGCCCCGCATA

Retrieve as FASTA