Entry information : PgigMnP01 (MnP-long)
Entry ID 9659
Creation 2011-11-09 (Christophe Dunand)
Last sequence changes 2011-11-09 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-03-27 (Catherine Mathe (Scipio))
Peroxidase information: PgigMnP01 (MnP-long)
Name (synonym) PgigMnP01 (MnP-long)
Class Manganese peroxidase    [Orthogroup: MnP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Phanerochaetaceae Phlebiopsis
Organism Phlebiopsis gigantea    [TaxId: 82310 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PgigMnP01
start..stop
S start..stop
CsuMnP04 613 0 1..380 1..377
PbreMnP05 608 0 1..382 1..382
PcMnP05 607 0 1..380 1..381
PgigMnP05 607 0 1..380 1..381
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 23249..23377 129 N° 2 23076..23194 119 N° 3 22851..23025 175 N° 4 22573..22794 222
N° 5 22100..22514 415 N° 6 21953..22047 95  
complement(join(21953..22047,22100..22514,22573..22794,22851..23025,23076..23194 ,23249..23377))


exon

Literature and cross-references PgigMnP01 (MnP-long)
DNA ref. JGI genome:   scaffold_51 (23377..21953)
Protein sequence: PgigMnP01 (MnP-long)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   384 (366)
PWM (Da):   %s   39282.27 (37627.3)  
PI (pH):   %s   4.03 (4.03) Peptide Signal:   %s   cut: 19 range:19-384
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFASLIALVALAAAVAAAPAKTKATCADGTQVNNAACCAFVPLATDLQDNLFLGDCGEDAHEAIRLTFHDAIAISRSQGPSVGGGADGSMLLFPTVEPLFVANNGISDSVNNLLHFLPLHNVTAGDLVQFAGAVALSNCGAPQLEFLAGRPNATAPAIDGLIPEPQDSVDKILARFADGGDFSPFEVVSLLASHSVARADKVDETIDAAPFDSTPFTFDTQIFLEVLLTGTGFPGTPNNTGEVASPLPTGSGTDVGELRLQSDFALARDARTACFWQGFVNEQAFMAASFKAAMAKLAVLGHDRADLVDCSDVVPAPKPAVGAPASFPATTGPDDLQLSCASEQFPTLSVDPGAQQTLVPHCSDGAMSCTTVQFDGPASNSS

Retrieve as FASTA  
Remarks Complete sequence from genomic (5 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTTGCTTCGCTCATCGCCCTCGTCGCGCTCGCCGCGGCCGTCGCCGCCGCGCCCGCCAAAACCAAGGCCACCTGCGCGGACGGCACGCAGGTGAACAACGCGGCGTGCTGCGCG
TTCGTCCCC
GTACGTACACCGGAGGCTGCGCCGTGCGCGGGTGCTGACGCTGCGCTGTGCCAGCTCGCGACGGACCTCCAGGACAACCTGTTCCTCGGGGACTGCGGCGAGGACGCGCAC
GAGGCCATCCGCCTGACCTTCCACGACGCCATCGCCATCTCCCGGAGCCAGGGCCCGAGCGT
GTACGTCCCTGCCGTGCGCGCGTTGCGGGCGCTGACCTTGGCTGCTGCAGCGGCGGCG
GCGCCGACGGCTCGATGCTCCTCTTCCCGACCGTCGAGCCGCTCTTTGTCGCCAACAACGGCATCTCCGACAGCGTCAACAACCTCCTCCACTTCCTGCCGCTCCACAACGTCACCGCCG
GCGACCTCGTCCAGTTCGCGGGCGCCGTCGCGCTCAGCAACTGCCCC
GTACGTCGTCGCTCGTGCCCCCGCCGAGAGGCTGCTGACGCGCGCCGGGTCCGCAGGGCGCGCCCCAGCTCGA
GTTCCTCGCCGGGCGCCCGAACGCGACGGCCCCCGCGATCGACGGCCTCATCCCGGAGCCGCAGGACAGCGTCGACAAGATCCTCGCGCGCTTCGCCGACGGCGGCGACTTCTCCCCCTT
CGAGGTCGTCTCGCTCCTCGCGTCGCACTCCGTCGCGCGCGCCGACAAGGTCGACGAGACCATCGACGCGGCGCCCTTTGACAGC
GTACGCCGCCGCCCGTGCCCCCCGCAGCGACGCGT
GCTGACGCCCCCACCCCCCGCAGACGCCCTTCACGTTCGACACCCAGATCTTCCTCGAGGTGCTCCTCACGGGCACCGGCTTCCCCGGCACGCCGAACAACACGGGCGAGGTCGCGTCGC
CGCTGCCGACGGGCAGCGGCACGGACGTCGGCGAGCTGCGGCTGCAGTCCGACTTTGCGCTCGCGCGCGACGCGCGCACGGCGTGCTTCTGGCAAGGGTTCGTGAACGAGCAGGCGTTCA
TGGCCGCGTCGTTCAAGGCCGCGATGGCGAAGCTCGCCGTGCTCGGGCACGACCGCGCGGACCTCGTCGACTGCTCCGACGTCGTGCCCGCGCCGAAGCCCGCCGTCGGCGCGCCCGCGT
CGTTCCCCGCGACGACCGGCCCCGACGACCTCCAGCTCTCGTGCGCGTCCGAGCAGTTCCCGACGCTCTCCGTCGACC
GTGAGTAGTCCGCCCCCTCGCTGCTGCTGCCGCCCGCGCTGA
CCGCCCCCAGCCGGCGCCCAGCAGACGCTCGTCCCGCACTGCTCCGACGGCGCCATGTCCTGCACCACGGTGCAGTTCGACGGCCCCGCGTCGAACAGCTCCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTTGCTTCGCTCATCGCCCTCGTCGCGCTCGCCGCGGCCGTCGCCGCCGCGCCCGCCAAAACCAAGGCCACCTGCGCGGACGGCACGCAGGTGAACAACGCGGCGTGCTGCGCG
TTCGTCCCC
CTCGCGACGGACCTCCAGGACAACCTGTTCCTCGGGGACTGCGGCGAGGACGCGCACGAGGCCATCCGCCTGACCTTCCACGACGCCATCGCCATCTCCCGGAGCCAGGGC
CCGAGCGT
CGGCGGCGGCGCCGACGGCTCGATGCTCCTCTTCCCGACCGTCGAGCCGCTCTTTGTCGCCAACAACGGCATCTCCGACAGCGTCAACAACCTCCTCCACTTCCTGCCGCTC
CACAACGTCACCGCCGGCGACCTCGTCCAGTTCGCGGGCGCCGTCGCGCTCAGCAACTGCCCC
GGCGCGCCCCAGCTCGAGTTCCTCGCCGGGCGCCCGAACGCGACGGCCCCCGCGATC
GACGGCCTCATCCCGGAGCCGCAGGACAGCGTCGACAAGATCCTCGCGCGCTTCGCCGACGGCGGCGACTTCTCCCCCTTCGAGGTCGTCTCGCTCCTCGCGTCGCACTCCGTCGCGCGC
GCCGACAAGGTCGACGAGACCATCGACGCGGCGCCCTTTGACAGC
ACGCCCTTCACGTTCGACACCCAGATCTTCCTCGAGGTGCTCCTCACGGGCACCGGCTTCCCCGGCACGCCGAAC
AACACGGGCGAGGTCGCGTCGCCGCTGCCGACGGGCAGCGGCACGGACGTCGGCGAGCTGCGGCTGCAGTCCGACTTTGCGCTCGCGCGCGACGCGCGCACGGCGTGCTTCTGGCAAGGG
TTCGTGAACGAGCAGGCGTTCATGGCCGCGTCGTTCAAGGCCGCGATGGCGAAGCTCGCCGTGCTCGGGCACGACCGCGCGGACCTCGTCGACTGCTCCGACGTCGTGCCCGCGCCGAAG
CCCGCCGTCGGCGCGCCCGCGTCGTTCCCCGCGACGACCGGCCCCGACGACCTCCAGCTCTCGTGCGCGTCCGAGCAGTTCCCGACGCTCTCCGTCGACC
CCGGCGCCCAGCAGACGCTC
GTCCCGCACTGCTCCGACGGCGCCATGTCCTGCACCACGGTGCAGTTCGACGGCCCCGCGTCGAACAGCTCCTAG

Retrieve as FASTA