Entry information : PgigMnP02 (MnP-long)
Entry ID 9660
Creation 2011-11-09 (Christophe Dunand)
Last sequence changes 2012-07-23 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-07-23 (Christophe Dunand)
Peroxidase information: PgigMnP02 (MnP-long)
Name (synonym) PgigMnP02 (MnP-long)
Class Manganese peroxidase    [Orthogroup: MnP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Phanerochaetaceae Phlebiopsis
Organism Phlebiopsis gigantea    [TaxId: 82310 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PgigMnP02
start..stop
S start..stop
CsuMnP10 662 0 1..384 1..378
CsuMnP05 650 0 1..384 1..377
PbreMnP04 644 0 1..387 1..383
PbreMnP01 644 0 1..384 1..380
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 56359..56484 126 N° 2 56543..56594 52 N° 3 56645..56671 27 N° 4 56722..56761 40
N° 5 56812..56986 175 N° 6 57040..57261 222 N° 7 57319..57733 415 N° 8 57777..57886 110
join(56359..56484,56543..56594,56645..56671,56722..56761,56812..56986,57040..572 61,57319..57733,57777..57886)


exon

Literature and cross-references PgigMnP02 (MnP-long)
DNA ref. JGI genome:   scaffold_130 (56359..57886)
Cluster/Prediction ref. JGI gene:   75606 [Incorrect prediction]
Protein sequence: PgigMnP02 (MnP-long)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   388 (370)
PWM (Da):   %s   40823.3 (39038.2)  
PI (pH):   %s   5.08 (4.85) Peptide Signal:   %s   cut: 19 range:19-388
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFKALLSLVALAAVSKAAPSKSTVCPGGTRVSNKACCAFIPLAEDLQKTVFGNDCGEDAHEMIRLIFHDAVAISRSKGPKAGGGADGSMLLFPTVEPSFSANNGIDDSVNNLIPFMARHPVSAGDLVQFAGAVALSNCGAPQLEFLAGRPNHTIAAIDGLIPEPQDDVTKILERFDDAGGFTPFEVVSLLASHTVARADKVDETIDAAPFDSTPFTFDTQVFLEVLLKGKGFPGTGNNTGEVTSPLPKGSGNDTGEMRLQSDFALARDSRTACFWQGFVNEQEFMAASFKSAVSKLAVLGHNRNDLIDCSDVVPEPKPAVKKPASFPATTGPQDLQLTCRTERFPSLTVDRRRFAGGAQQSLIPHCSDGQQSCNTVQFSGPAMASS

Retrieve as FASTA  
Remarks Complete sequence from genomic (7 introns). Incorrect prediction from JGI (fusion of two tandem duplicated genes).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCAAGGCACTTTTGTCTCTCGTCGCTCTTGCCGCTGTCTCTAAGGCCGCACCGTCGAAGTCGACAGTGTGCCCCGGTGGCACTCGCGTTTCCAACAAAGCTTGTTGTGCTTTC
ATTCCA
GTCGGTGCTCTTCACGCTTTTAGATGCCCCCCAAACTCAATTAAATTTGCCTCTTCAGCTGGCAGAGGATCTGCAGAAGACCGTCTTCGGGAATGACTGTGGCGAGGACGGTAC
GCATTTCTTATAATTGTGAAAACATGTACTAAGGCCGTATTTACAGCTCACGAAATGATTCGCCTGATTTTCCGTCAGTAAGATTTATGTGTCCTGGTCAGTGTATTGACACCGTGACCG
TAGATGACGCCGTGGCGATTTCTCGTAGCAAAGGCCCCAAAGCGTACGTCCTCGCAGCAGGTCTCTAGCCCACTAATTTAAAATTCTACACAGCGGCGGAGGAGCTGACGGCTCGATGCT
CCTGTTCCCCACTGTCGAACCATCTTTTTCTGCCAACAATGGTATCGACGACTCTGTGAACAACCTCATCCCGTTCATGGCCAGGCACCCTGTTTCTGCTGGCGACCTCGTCCAGTTTGC
TGGCGCCGTCGCTCTCAGTAACTGCCCT
GTAAGTGCTAATGAACCACCGCCGAATCTAAACTGACCAGCAGTACTCAACAGGGTGCACCCCAGCTGGAGTTCTTGGCCGGTCGTCCCAAC
CACACCATCGCCGCCATCGACGGCCTGATCCCCGAGCCGCAAGACGATGTGACCAAGATTCTCGAGCGTTTCGACGACGCTGGAGGTTTCACTCCCTTTGAGGTCGTCTCCCTCCTGGCG
TCGCACACTGTCGCCCGCGCCGACAAGGTCGATGAGACCATAGACGCTGCTCCGTTCGACTCC
GTGAGCACTACATCTTCACTTCCATGGCATATGCATTCTGACACTCACTCGTGATAG

ACTCCCTTCACATTTGACACTCAGGTCTTCCTCGAGGTTTTACTCAAGGGCAAGGGCTTCCCCGGAACCGGAAACAACACCGGCGAGGTCACATCCCCTCTCCCGAAGGGCAGCGGCAAC
GACACCGGCGAGATGCGTCTCCAGTCCGACTTCGCCCTAGCCCGCGACTCGCGCACCGCCTGCTTCTGGCAGGGCTTCGTCAACGAGCAGGAGTTCATGGCCGCCAGCTTCAAGTCTGCG
GTGTCCAAGCTCGCCGTGCTGGGCCACAACCGCAACGACCTGATCGACTGCTCCGACGTCGTCCCCGAGCCCAAGCCCGCCGTCAAGAAGCCCGCAAGCTTCCCCGCAACCACTGGCCCT
CAGGACCTGCAGCTCACCTGCAGGACCGAACGTTTCCCCTCGCTCACCGTCGACC
GTGAGTCTATAGCACTCCGCACCCACGAGCATCGTCTAAATAGGTCGTCGATTTGCAGGAGGCGC
TCAGCAGTCGCTTATCCCTCACTGCTCAGACGGTCAGCAGAGCTGCAATACTGTGCAGTTCAGCGGTCCTGCTATGGCTTCCTCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCAAGGCACTTTTGTCTCTCGTCGCTCTTGCCGCTGTCTCTAAGGCCGCACCGTCGAAGTCGACAGTGTGCCCCGGTGGCACTCGCGTTTCCAACAAAGCTTGTTGTGCTTTC
ATTCCA
CTGGCAGAGGATCTGCAGAAGACCGTCTTCGGGAATGACTGTGGCGAGGACGCTCACGAAATGATTCGCCTGATTTTCCATGACGCCGTGGCGATTTCTCGTAGCAAAGGCCCC
AAAGC
CGGCGGAGGAGCTGACGGCTCGATGCTCCTGTTCCCCACTGTCGAACCATCTTTTTCTGCCAACAATGGTATCGACGACTCTGTGAACAACCTCATCCCGTTCATGGCCAGGCAC
CCTGTTTCTGCTGGCGACCTCGTCCAGTTTGCTGGCGCCGTCGCTCTCAGTAACTGCCCT
GGTGCACCCCAGCTGGAGTTCTTGGCCGGTCGTCCCAACCACACCATCGCCGCCATCGAC
GGCCTGATCCCCGAGCCGCAAGACGATGTGACCAAGATTCTCGAGCGTTTCGACGACGCTGGAGGTTTCACTCCCTTTGAGGTCGTCTCCCTCCTGGCGTCGCACACTGTCGCCCGCGCC
GACAAGGTCGATGAGACCATAGACGCTGCTCCGTTCGACTCC
ACTCCCTTCACATTTGACACTCAGGTCTTCCTCGAGGTTTTACTCAAGGGCAAGGGCTTCCCCGGAACCGGAAACAAC
ACCGGCGAGGTCACATCCCCTCTCCCGAAGGGCAGCGGCAACGACACCGGCGAGATGCGTCTCCAGTCCGACTTCGCCCTAGCCCGCGACTCGCGCACCGCCTGCTTCTGGCAGGGCTTC
GTCAACGAGCAGGAGTTCATGGCCGCCAGCTTCAAGTCTGCGGTGTCCAAGCTCGCCGTGCTGGGCCACAACCGCAACGACCTGATCGACTGCTCCGACGTCGTCCCCGAGCCCAAGCCC
GCCGTCAAGAAGCCCGCAAGCTTCCCCGCAACCACTGGCCCTCAGGACCTGCAGCTCACCTGCAGGACCGAACGTTTCCCCTCGCTCACCGTCGACC
GTCGTCGATTTGCAGGAGGCGCT
CAGCAGTCGCTTATCCCTCACTGCTCAGACGGTCAGCAGAGCTGCAATACTGTGCAGTTCAGCGGTCCTGCTATGGCTTCCTCTTGA

Retrieve as FASTA